SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000010807 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000010807
Domain Number 1 Region: 229-464
Classification Level Classification E-value
Superfamily Mitochondrial carrier 3.79e-63
Family Mitochondrial carrier 0.00013
Further Details:      
 
Domain Number 2 Region: 41-221
Classification Level Classification E-value
Superfamily EF-hand 1.76e-35
Family Calmodulin-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000010807   Gene: ENSPCAG00000011555   Transcript: ENSPCAT00000011572
Sequence length 473
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_5920:4612:41468:1 gene:ENSPCAG00000011555 transcript:ENSPCAT00000011572 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSSVLCRCLASPPPDAAAAAASSSASSIGDPCGGAVCGGPDHKLRLWSLFQTLDVNRDG
GLCVNDLAVGLQRLGLHRTEGELRKIVQAGDKDLDGQLDFEEFVHYLQDHEKKLRLVFKS
LDKKNDGRIDAQEIRQSLQDLGVKISEQQAEKILKRIRTGHFWGPVTYMDKDGTMTIDWN
EWRDYHLLHPVENIPEIILYWKHSTIFDVGENLTVPDEFTVEERQTGMWWRHLVAGGGAG
AVSRTCTAPLDRLKVLMQVHASRSNMCIVGGFTQMIREGGARSLWRGNGINVLKIAPESA
IKFMAYEQIKRLVGSDQETLRIHERLVAGSLAGAIAQSSIYPMEVLKTRMALRKTGQYSG
MLDCARKILAKEGVAFYKGYVPNMLGIIPYAGIDLAVYETLKNVRLDLGKVQMSIEGAPE
VTMSSLFKHILRTEGAFGLYRGLAPNFMKVIPAVSISYVVYENLKITLGVQSR
Download sequence
Identical sequences ENSPCAP00000010807 ENSPCAP00000010807

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]