SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000011929 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000011929
Domain Number 1 Region: 396-537
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.75e-23
Family MAM domain 0.0011
Further Details:      
 
Domain Number 2 Region: 88-127
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000028
Family EGF-type module 0.0053
Further Details:      
 
Domain Number 3 Region: 44-127,213-254
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000502
Family Growth factor receptor domain 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000011929   Gene: ENSPCAG00000012756   Transcript: ENSPCAT00000012768
Sequence length 541
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_5699:22276:102335:1 gene:ENSPCAG00000012756 transcript:ENSPCAT00000012768 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLLLVLLLASSLYLQAAAEFDGRWPRQIVSSIGLCRYGGRIDCCWGWARQSWGQCQPVC
QPQCKHGECVGPNKCKCHPGYAGKTCNQDLNECGLKPRPCKHRCMNTFGSYKCFCLSGYM
LMPDGSCSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIDECLGQHHCSTFARCYNIHGSYKCK
CKDGYQGDGLSCVXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXDWTGEGILIHSCNFDHGLCGWIREKDNDLHWEPV
RDPAGGQYLRVSAAKGPGGKAARLILPLGHLMHSGDLCLSFRHKVTGRHSGTLQVFVRKH
GTHGAALWGRNGGHGWRQTQITLREADVKSVIFKGEKRRGPSGEIGLDDVSLRKGHCSEE
P
Download sequence
Identical sequences ENSPCAP00000011929 ENSPCAP00000011929

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]