SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000012272 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000012272
Domain Number 1 Region: 252-304
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000383
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 2 Region: 172-217
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000211
Family Classic zinc finger, C2H2 0.026
Further Details:      
 
Domain Number 3 Region: 224-260
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000468
Family Classic zinc finger, C2H2 0.035
Further Details:      
 
Domain Number 4 Region: 310-363
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000251
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Weak hits

Sequence:  ENSPCAP00000012272
Domain Number - Region: 126-152
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0662
Family Classic zinc finger, C2H2 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000012272   Gene: ENSPCAG00000013133   Transcript: ENSPCAT00000013133
Sequence length 518
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_4309:88455:93234:1 gene:ENSPCAG00000013133 transcript:ENSPCAT00000013133 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPPGKVPRKENLGLQCEWGSCSFVCSSMEEFCEHVTQHLQQHLHSSEEEEEDEEDPLEE
EFSCLWQECGFCSLDSPADLIRHVFFHCYHTKLKQWGLQALQSQADLSPCILDFQSRNVV
PDIPDHFLCLWEHCESSFDNPEWFYRHVEAHSLCCEYQAVGRDNHVVLCGWKGCTCTFKD
RCKLREHLRSHTQEKVVACPTCGGMFANNTKFLDHIRRQTSLDQQRFQCSHCSKRFATER
LLRDHMRNHVNHYKCPLCDMTCPLPSSLRNHMRFRHSEDRPFKCDCCDYSCKNLIDLRKH
LDTHSTEPAYRCDVESCSFSARSLCSVKSHFRKVHEGDSEPRYKCHVCDKCFTRGNNLTV
HLRKKHQFKWPSGHPRFRYKEHEDGYMRLQLVRYESVELTQQLLQQPQEGSGLGASLSEN
SLQGIFLERVSGEPGPEEEAEEDEEGEGSEGTALSAPEDAPSPVIHMVNQTIAEGQQEIV
YYVLSEAPREPPCPAELPSGGIVGKLQGTAEDPEVHMV
Download sequence
Identical sequences ENSPCAP00000012272 ENSPCAP00000012272

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]