SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000012354 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000012354
Domain Number 1 Region: 221-277
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.67e-21
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 2 Region: 277-329
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.26e-18
Family Classic zinc finger, C2H2 0.0061
Further Details:      
 
Domain Number 3 Region: 182-234
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000279
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 4 Region: 112-161
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000259
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000012354   Gene: ENSPCAG00000013279   Transcript: ENSPCAT00000013221
Sequence length 329
Comment pep:novel scaffold:proCap1:scaffold_223299:7:993:-1 gene:ENSPCAG00000013279 transcript:ENSPCAT00000013221 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IQKVDDHLLGYLQNENKVDRLKQCCEHNALKNIVYQHKNHLSLRENNAVFDLREKTVKSN
FMSPAVNQNRNDEMKNSAELNGDEKTFLSADQEQFCAEMEFPENQKSNSIRSKCIDNLKT
QKKEKSHVYSECGKAFLRGSSLVEHQIIQTGEKPCRFITCGDNSVTVFKLTEHHHTSREG
QKAHKHMGCDKAHLSKSKLNRPKRTLMPERPYICNDCGKGFIWKSNFAVHQCIHTVKKPY
ICTKCEKTFASKSYLTVHQRVHTGEKPHICSECGKRFTWKSQLTVHQRVHTGENPNICNE
SGKAFPWKSLLTVQQWVHSGEKPYVCSEC
Download sequence
Identical sequences ENSPCAP00000012354 ENSPCAP00000012354

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]