SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000012578 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000012578
Domain Number 1 Region: 95-212
Classification Level Classification E-value
Superfamily PX domain 0.000000000101
Family PX domain 0.0033
Further Details:      
 
Domain Number 2 Region: 295-349
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000216
Family SAM (sterile alpha motif) domain 0.0052
Further Details:      
 
Domain Number 3 Region: 893-923
Classification Level Classification E-value
Superfamily Retrovirus zinc finger-like domains 0.00000272
Family Retrovirus zinc finger-like domains 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000012578   Gene: ENSPCAG00000013438   Transcript: ENSPCAT00000013458
Sequence length 947
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_3736:20925:74716:-1 gene:ENSPCAG00000013438 transcript:ENSPCAT00000013458 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASNHPAFSFHQKQVLRQELTQIQSSLSGGHGSGHSGGKGAPGPTCPACHKITPRTETPI
NSVSNSLENALHTSAHSIEESLPRRPLGKHSKVSVEKIDLKGLSHKKNERNVECSFEVLW
SDSSVTSVTKSSFEVTEFISKLSQLYPEENWEKFIPCLAGPDSFYVERNHMDLEPDLYLA
SLPSHILKNEHVKKFFSTSSPTQQLQSPSPGNPSLSKVGTMMGVSGRPVCGVAGIPSPQN
STQHHMQHSAGAAATLPHCAHPAGTGSALTYRAQMDTSPTILMSSSLQSPQTQEQNGILD
WLRKLRLHKYYPVFKQLTMEKFLSLTEEDLNKFESLTMGAKKKLKTQLELEKEKSEKRCL
NPSAPPSVTSTGVARVPPTSHVGPLQPMRGTHAAELRVEVEPPAHQGPREGSSSEYSSSS
SSPMGVQAREESSDSAEENDRRAEVHLEGSEKEKPVMLLNHFPSSSARPTAQVLPVQNEA
GSSTAGHHPLPPQMMPSASHLAPMRLLSSVHKAERGAADVKLLSASMHSLLSLEDRGKVS
GPRSSVKVDKGFGNALMDVLPAPTPHQPVQVLAAVPEGSSLSPAVSFGPRAKVVHASALD
RVMKTAQQPTLVVDTSTAATGTSSSVFQVARPPIKLLVSSSVPADSAISGQTSCSNSVQI
SVPPAIINPRTALYTANTKVAFSAVSSVPVGPMQGSFCANSNTASSSSHPSTSFANMANL
TSCPAPSPSPTLSSIPENNFYSSSSGSSSCTGNISASTQNHHHHHHHQQQPAPPQPAPPP
PGCIVCTSCGCSGSCGSSGLTVSYANYFQHPFSGPSMFTFPFLPFSPMCSSGYVGTQQYG
GGAAFPVVHAPYSGSLAADSVLGGQSTFAVPPMQNFMAGSAGVYQTQGLLGSSNGSNHKK
SGNLSCYNCGATGHRAQDCKQPSMDFNQQGTFRLKYAPPAESLDSTD
Download sequence
Identical sequences ENSPCAP00000012578 ENSPCAP00000012578

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]