SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000012891 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000012891
Domain Number 1 Region: 267-323
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.71e-23
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 2 Region: 24-80
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.57e-20
Family KRAB domain (Kruppel-associated box) 0.0022
Further Details:      
 
Domain Number 3 Region: 211-267
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.44e-20
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 4 Region: 308-360
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.15e-18
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 5 Region: 174-224
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000118
Family Classic zinc finger, C2H2 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000012891   Gene: ENSPCAG00000013838   Transcript: ENSPCAT00000013792
Sequence length 408
Comment pep:novel genescaffold:proCap1:GeneScaffold_7151:17506:19659:-1 gene:ENSPCAG00000013838 transcript:ENSPCAT00000013792 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVSPLAPFPSGEPDQARPKCRKAEPVSFADVAVYFSAEEWACLRPAQRALYRDVMRETYG
HLGALGFRGRKPALISWVEEEAELWGPDAQDPEAGKGLTEAATADSRNEEKGETGEMEAL
EQILFMAPRPPGLKALKPPPAGVPYGLEQPSRVPHRGRPPLCVHPPVPRADQRHGCYVCG
KSFAWRSTLVEHLYTHTGEKPFCCPDCGKGFGQASSLSKHRAIHRGERPHRCPDCGRAFT
QRSALTTHLRVHTGEKPYRCADCSRCFSQSSALYQHQRVHSGETPFSCPDCGRAFAHASD
LRRHVRTHTGEKPYPCPDCGRCFRQSSEMAAHRRTHSGERPYPCPQCGRCFGQKSAMAKH
QWVHRPGAGGHRGHQSVSELPVSLTSGQGDLDPPVGFQYYPEIFQECG
Download sequence
Identical sequences ENSPCAP00000012891 ENSPCAP00000012891

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]