SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000013128 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000013128
Domain Number 1 Region: 11-208
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.48e-38
Family Laminin G-like module 0.0018
Further Details:      
 
Domain Number 2 Region: 663-735
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000628
Family VWC domain 0.022
Further Details:      
 
Domain Number 3 Region: 417-565
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000113
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 4 Region: 570-612
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000486
Family EGF-type module 0.02
Further Details:      
 
Weak hits

Sequence:  ENSPCAP00000013128
Domain Number - Region: 314-371
Classification Level Classification E-value
Superfamily FnI-like domain 0.00023
Family VWC domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000013128   Gene: ENSPCAG00000014013   Transcript: ENSPCAT00000014050
Sequence length 791
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_5453:120629:413256:1 gene:ENSPCAG00000014013 transcript:ENSPCAT00000014050 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VGFGMDPDLQMDIISELDLVNTTLGVTQVSGLKNTSKAFLFQDAEREIHAAPHVSEKLIQ
LFQNKSEFTFLATVRQKASTSGVILSIRELEHSYFELESSGLRDEIRYHYIHNGKPRTEA
FPYRMADGQWHKVALSVSASHLLLHVDCNRIYERVIDPPETNLPPGSNLWLGQRNQKHGL
FKGTIQDGKIIFMPNGYITQCPNLNRTCPTCSDFLSLVQGIMDLQELLAKMTAKLNYAET
RLSQLENCHCEKTCQVSGLLYRDQDSWVDGDHCRNCTCKXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXKCIYGGKVLAEGQRILTRSCRECRGGVLVKITEACPPLNCSEKDHI
LPENQCCSVCKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIDECA
AKMHYCHANTVCVNLPGLYRCDCVPGYIRVDDFSCTEHDECGSGQHNCDKNAICTNTVQG
HSCTCKPGYVGNGTICRAFCEEGCRYXXXXXXXXXXXXXXXXXXXXXXXXIDECTEGIIE
CHNHSRCVNLPGRYHCECRSGFHDDGTYSLSGDSCVDIDECALRTHTCWNDSACINLAGG
FDCLCPSGPSCSGDCPHDGGLKRNGQVWTLKEDRCSVCSCKDGKIFCRRTACDCQNPSAD
LFCCPECDTRVTSQCLDQNGHKLYRSGDNWTHSCQQCRCLEGEVDCWPLACPNLSCEYTA
ILEGECCPRCVSDPCLADNITYDIKKTCLDSYGVSRLSGSVWIMSGSPCTTCKCKNGSVC
CSVDLECLHNN
Download sequence
Identical sequences ENSPCAP00000013128 ENSPCAP00000013128

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]