SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000013212 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000013212
Domain Number 1 Region: 153-209
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.59e-24
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 2 Region: 208-265
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.46e-21
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 3 Region: 116-166
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.12e-18
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 4 Region: 254-306
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.39e-18
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 5 Region: 392-444
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000258
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000013212   Gene: ENSPCAG00000014182   Transcript: ENSPCAT00000014142
Sequence length 446
Comment pep:known_by_projection scaffold:proCap1:scaffold_41949:8676:10516:-1 gene:ENSPCAG00000014182 transcript:ENSPCAT00000014142 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ISRPSIISQLEHKEGSWVLQLQNFEEKEILRESDTDFENQVAKLNQNFSETAEQGGTSSE
RANKNISRTSSGRRNWERDFELEGRHGTLLGVGQQEPFSQERDLNKLLDGYVGKKPVCTE
CGKSFNQSSYLIRHLRTHTGERPYKCTECGKGFKQSSDLVTHHRTHTGEKPYKCSGCEKK
FSDSSTLIKHQRTHTGERPYECPECGKSFGRKPHLIMHQRTHTGEKPYTCLECHKSFSRS
SNFITHQRTHTGVKPYRCHDCGESFSQSSDLIKHLRTHTGERPFKCPECGKGFRDSSHFV
AHVSTHSGEXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXHLDRPYQCHECGKTNQRSHFLTHQRTHTGEK
PFHCSKCDKSFHQKAHLLCHQNTHLI
Download sequence
Identical sequences ENSPCAP00000013212 ENSPCAP00000013212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]