SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000013331 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000013331
Domain Number 1 Region: 117-205
Classification Level Classification E-value
Superfamily Snake toxin-like 1.25e-34
Family Extracellular domain of cell surface receptors 0.0000344
Further Details:      
 
Domain Number 2 Region: 210-291
Classification Level Classification E-value
Superfamily Snake toxin-like 8.25e-18
Family Extracellular domain of cell surface receptors 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000013331   Gene: ENSPCAG00000014292   Transcript: ENSPCAT00000014267
Sequence length 331
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_6258:122030:132200:-1 gene:ENSPCAG00000014292 transcript:ENSPCAT00000014267 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRPPLLLSLLLLAHTCVSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRDFPLPQSRYPSVSCA
SSDLSCERDLGQSLQCRNPGEQCLEVVTHRSLEWSPEDERHSRGCGYLPGCPGPTGFHNN
HTFHFLRCCNTTRCNEGPVLELENLPLNDFQCYSCEGNSTDGCTIEETSLISCRGPMTQC
LEATGSNDLGIPSFTVRGCATPSWCQGLHVAEAFSMTHVNVTCCSGNGCNHPARDAQPRM
GGSPQPGPTHLSLFVTLLMTVRLWGGTVIWS
Download sequence
Identical sequences ENSPCAP00000013331 ENSPCAP00000013331

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]