SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000013453 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000013453
Domain Number 1 Region: 264-455
Classification Level Classification E-value
Superfamily Nudix 2.71e-42
Family NADH pyrophosphatase 0.0012
Further Details:      
 
Domain Number 2 Region: 9-100
Classification Level Classification E-value
Superfamily Ankyrin repeat 3.11e-20
Family Ankyrin repeat 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000013453   Gene: ENSPCAG00000014423   Transcript: ENSPCAT00000014396
Sequence length 461
Comment pep:known_by_projection scaffold:proCap1:scaffold_3139:40129:49829:-1 gene:ENSPCAG00000014423 transcript:ENSPCAT00000014396 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSIEANPNKEIISQFHCSAAEGDIAMLTTILSHSPSLLNETSENGWTALMHAARNGHPD
VVQLLLEKGCDRSIVNKSRQTALDIAKFWGYKHIANLLANAKGGKKPWFLTSEVEECENY
FSRTLLDRKSEKRSNSDWLLAKESHPATVYILFSDLNPLVTLGGNKESFQQPEVRLCQLT
HTDVKDYLAQPEKITLVFLGVELEVKKELQNYAEEVPKEEEDGLVAWFALGIDRIAAEEF
KQSHENCYFLHPPMPALLQLKEKEAGVIAQARAVLAWHSRYKFCPTCGNATKIEEGGYKR
VCLKEGCPSLYGVHNTSYPRVDPVVIMQVIHPDGTKCLLGRQKRFPPGMFTCLAGFIEPG
ETIEDAVRREVEEESGVRVGHVQYVSCQPWPMPSLMIGCLAVAVSTEIKVDKNEIEDARW
FTREQVVDVLTKGKQQAFFVPPSRAIAHQLIKHWIGMNANL
Download sequence
Identical sequences ENSPCAP00000013453 ENSPCAP00000013453

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]