SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000013723 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000013723
Domain Number 1 Region: 504-667
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.01e-47
Family Protein kinases, catalytic subunit 0.0000000676
Further Details:      
 
Domain Number 2 Region: 2-123
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 4.82e-24
Family PLC-like (P variant) 0.0000413
Further Details:      
 
Domain Number 3 Region: 143-211
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000000209
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0058
Further Details:      
 
Domain Number 4 Region: 393-451
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 0.000000794
Family Protein kinases, catalytic subunit 0.0000438
Further Details:      
 
Weak hits

Sequence:  ENSPCAP00000013723
Domain Number - Region: 264-285
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00284
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000013723   Gene: ENSPCAG00000014659   Transcript: ENSPCAT00000014688
Sequence length 705
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_513:14527:106261:-1 gene:ENSPCAG00000014659 transcript:ENSPCAT00000014688 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSPFLRIGLSNFDCGSCQPSQGEAVNPYCAVLVKEFVESENGQMYVQKKPTMYPPWDSTF
DAHINKGRVMQIIVKGKNVDLISETTVELYSLAERCRKNNGKTEIWLELKPQGRMLMNAR
YFLEMSDTKDMSEFETEGFFALHHRRGAIKQAKVHHVKCHEFTATFFPQPTLWSVCHEFV
WGLNKQGYQCRQCNAAIHKKCIDKVIAKCTGSAVNSRETMXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXCGMNVHHRCQTKVANLCGINQKLMAEALAMIESTQQ
ARCLRDTEHIFREGPVEIGLPCSLKEETRLPYLPTPGKRXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVFLAEFKKTNQFFAIKALKKDVVLMDD
DVECTMVEKRVLSLAWEHPFLTHMFCTFQTKXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXDLKLDNILLDKDGHIKIADFGMCKENMLGDARTNTFC
GTPDYIAPEILLGQKYNHSVDWWSFGVLLYEMLIGQSPFHGQDEEELFHSIRMDNPFYPR
WLEKEAKDLLVKLFVREEKRLGVRGDIRQHPLFREINWEELERKDIEPPFKPKVXXXXXX
XXXXXXXXXXXXRLSCADRALINSMDQNMFRNFSFVNPGMERLIS
Download sequence
Identical sequences ENSPCAP00000013723 ENSPCAP00000013723

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]