SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000014275 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000014275
Domain Number 1 Region: 278-334
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.96e-25
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 2 Region: 389-446
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.09e-20
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 3 Region: 333-390
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.57e-20
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 4 Region: 450-500
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.99e-18
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 
Weak hits

Sequence:  ENSPCAP00000014275
Domain Number - Region: 2-39
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 0.00458
Family SCAN domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000014275   Gene: ENSPCAG00000015283   Transcript: ENSPCAT00000015264
Sequence length 520
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_6921:40577:46877:1 gene:ENSPCAG00000015283 transcript:ENSPCAT00000015264 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLQQLLITLPSEASNWVKLHHPRRAKQGMPLWEDVTEMLQREXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXKEVPGDASSELKSETETNDSTTRDIPQEQLYRSIMIERSMRD
DIIYSTLRKVSKYHDDLRRCQKTCGSGVRQAILTHKNSGQETNKSVEHIVSSNVIIEQRH
YKHDTPKKRSIYNLDFINHPAVYIRTRAIQCNICEKIFKQPIHLSEHMRIHTGEKPFRCK
ECGRAFSQSASLKTHQRIHTGEKPYVCEECGKAFRHRSSLNQHRRTHTGEKPCVCDKCQK
AFSQHVSLIQHLRTHSGEKPFMRSECGKTFRQIRHLSEHLRIHTGEKPYACTLCCKTFSH
RAYLTHHQRIHTGEKPYKCKEYGKPFRQRISNHKTVHTGVKAYECNRCGKAYRHDSSFKK
HQRHHSGEKPYECNECGKAFSYISSLSRHHEMHRRNSFPD
Download sequence
Identical sequences ENSPCAP00000014275 ENSPCAP00000014275

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]