SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000014697 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000014697
Domain Number 1 Region: 349-525
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 8.24e-55
Family Regulator of G-protein signaling, RGS 0.000000028
Further Details:      
 
Domain Number 2 Region: 987-1111
Classification Level Classification E-value
Superfamily PH domain-like 4.2e-41
Family Pleckstrin-homology domain (PH domain) 0.000000615
Further Details:      
 
Domain Number 3 Region: 746-892
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.93e-29
Family DBL homology domain (DH-domain) 0.000000105
Further Details:      
 
Domain Number 4 Region: 76-121
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000000000828
Family PDZ domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000014697   Gene: ENSPCAG00000015555   Transcript: ENSPCAT00000015711
Sequence length 1555
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_7266:105672:194453:-1 gene:ENSPCAG00000015555 transcript:ENSPCAT00000015711 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSVRPPQSIDRLTSLSSLGDSASERKSPSHHRQPSDACETAXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXGAAMKAGVKEGDRIIKVNGTMVTNSSHLEVVKLIKSGAYVALTLL
GSSPSSVGVSGLQQDPGPAGAPRVTPMIPLPPPPPPLPPPQRITGPKPLQDPEVQKHATQ
ILRNMLRQEEKELQRICEVYNRNPATLLEEQIEGARRRVSQLQLKIQQETGGLVDILPLY
GDTSQRSSEGRLSLDSQEGDSGLDSGTERFPSLSESLWNRNSVLSDPGLDSPRTSPVIMT
RMALHHRWQGSDAPVPSSDQGIDQSPKPLIIGPEEDYDPGYFNNESDTIFQDLEKLKSHP
AHLGVFLRYIFSQADPSPLLFHLCAEVYQQTNPKDSRSLGKDIWNIFLEKNAPLRVKIPE
MLQAEIDLRLRNSEDVRNILGEAQEAAMPEIQEQIHDYRTKRTLGLGSLYGENDLLDLDG
DPLRERQVAEKQLAALGDILSKYEEDRXXPMDFALNTYMSHAGIRLREARPSNPAEKAQS
ADKDKWLPFFSSNSKKEKDALEDKKRNPILKYIGKPKNSSQSXXXXXXXXXXXKPGNVRN
IIQHFENNQQYDTPEPGTQRLSTGSFPEDLLESDXXXXXXXXXXXXXXXXREEMKRSRKA
ENVPRSRSDVDMDAAAEATRLHQSASSSASSLSTRSLENPTPPFTPKMGRRSIESPNLAF
CTDILPHLLEDDLGQLSDLEPEPDAQNWQHTVGKDVVAGLTQREIDRQEVINELFVTEAS
HLRTLRVLDLIFYQRMKKENLMTREELARLFPNLPELIEIHNSWCEAMKRLREEGPIIKE
ISDLMLARFDGAARDELQQVAAQFCSYQSIALELIKTKQRKESRFQLFMQXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXSLDLTTRKMIHEGPLTWRISKDKTLDLHVLL
LEDLLVLLQKQDEKLLLKCHSKTAVGSSDSKQTFSPVLKLNAVLIRSVATDKRAFFIICT
SELGPPQIYELVALTSSDKNIWMELLEEAVRNATRHPGAALPPIHPPPPGPQEVAHQSLA
PSRVGLDDSEVFHRRCSEPEPEELPAGPRPQQRVRQTDPVLLKDAEQEGTREEEKLGAPP
HPSLPMDGENVDVRTRDPIHLPLPGPLFMEGLAEAALEDVENLRHLILCSLLPSHTMEPQ
ATGEPEDDLTPTPSVISITSHPWDPGSPGRAPTGGEGNNTQLPRLEGGQPELEDVALCSL
EHLPPRTRNSGIWECPELDKNPAEQTSSTEAAGSYKVVRKAEVTGSKVVPALPESGQSEP
EPPDVEGGAKAAGNYFYVSMPAGPVDSSTDLSGAPTSPAQPDSHPTWQKEPHPQPRRGNA
DPRHPSCSPPSLALRDVGMIFRTIEQLTLKLNRLKDLELAHRELLKSFGGESSGGTTPVG
SFHTEAARWTDSSLSPPVKEPLVSDSRDTHELGPCPVDSSDTPLEDTATATSPGL
Download sequence
Identical sequences ENSPCAP00000014697 ENSPCAP00000014697

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]