SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000015081 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000015081
Domain Number 1 Region: 326-382
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.35e-22
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 2 Region: 438-494
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.96e-22
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 3 Region: 381-438
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.78e-21
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 4 Region: 287-339
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.54e-17
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 5 Region: 104-141
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000000000209
Family KRAB domain (Kruppel-associated box) 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000015081   Gene: ENSPCAG00000016123   Transcript: ENSPCAT00000016114
Sequence length 534
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_7687:27066:31741:1 gene:ENSPCAG00000016123 transcript:ENSPCAT00000016114 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VPGHQHPRREMLSESDETGPQGAAPELPRIKTEPEDPPTEGPSQEVGAPSARRWTLLSRG
PREKPRLLPGGGRPSPQAPPLSREGRVREGRVRDRQIAAALLTAWSRMPVTFEDVALYLS
QEEWGRLDHTQQIFYREALQRKGLSVGFPLNRPLWASQVQRKGEASSSGQQAGEEEEEKT
AVCTEAVEVKKKAPATTVLGDVKPFRTTAGRDAGSSPQCEQLASSSQGSAQTVVYRRASS
TKPKIAMLATGFPETQKGSVSKKFSEEGETSSERGQVTLAAEINGSKIYKCEQCAKGFSW
HSHLVTHLRTHSGERPYICTDCGKGFVSSSHLIQHQIVHTGDKPYTCPSCGKSFSHHSTL
IQHQRIHSGEKPHVCDSCDKSFTRHADLVTHQATHTGAKPYKCPVCSKCFTHSSALASHR
RTHTGIKPYPCPECGKCFSQRSNLVAHNRTHTGEKPYHCLECGKSFTQSSRLTAHQRTHR
GVRPYSCPLCGKSFSRRANLHRHEKIHTTGPKTLAVLMQGAAADTLAAPSPAPT
Download sequence
Identical sequences ENSPCAP00000015081 ENSPCAP00000015081

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]