SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000015249 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000015249
Domain Number 1 Region: 208-430
Classification Level Classification E-value
Superfamily Mitochondrial carrier 6.8e-63
Family Mitochondrial carrier 0.0000854
Further Details:      
 
Domain Number 2 Region: 8-160
Classification Level Classification E-value
Superfamily EF-hand 5.82e-32
Family Calmodulin-like 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000015249   Gene: ENSPCAG00000016281   Transcript: ENSPCAT00000016292
Sequence length 430
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_2733:4083:30660:-1 gene:ENSPCAG00000016281 transcript:ENSPCAT00000016292 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGGPGDAERRQRWGRLFEELDSNKDGRVDVHELRRGLARLGGGDPDSSAQQGISPESSA
DPDGGLDLEEFSRYLQEREQRLLLMFHSLDRNQDGHIDVSEIQQSFRALGISISLEQAEK
ILHSMDRDGTMTIDWQEWRDHFLLHSLENVEDVVYFWKHSTLSSAGFCGMMDLAALQQES
KAIVVLDIGECLTVPDEFSEQEKQTGMWWKQLVAGAVAGAVSRTGTAPLDRLKVFMQVHA
SKTNRLDVLGGLRSMIREGGVCCLWRGNGINVLKIAPESAIKFMAYEQIKRAIRGQQETL
QVQERFVAGSLAGATAQTVIYPMEVLKTRLTLRRTGQYKGLWDCALQILEQEGPRAFYRG
YLPNMLGIIPYAGIDLAVYETLKNRWLQQYSHDSADPGILVLLACGTVSCTCGQIASYPL
ALVRTRMQAQ
Download sequence
Identical sequences ENSPCAP00000015249 ENSPCAP00000015249

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]