SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000015300 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000015300
Domain Number 1 Region: 44-132
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 5.95e-36
Family SCAN domain 0.0000465
Further Details:      
 
Domain Number 2 Region: 414-471
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.74e-26
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 3 Region: 470-527
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.03e-26
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 4 Region: 514-572
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.7e-22
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 5 Region: 358-415
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.65e-21
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 6 Region: 320-372
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.49e-20
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 7 Region: 219-271
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 0.0000000051
Family KRAB domain (Kruppel-associated box) 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000015300   Gene: ENSPCAG00000016377   Transcript: ENSPCAT00000016345
Sequence length 578
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_7261:34173:39771:1 gene:ENSPCAG00000016377 transcript:ENSPCAT00000016345 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAESGKPSAESPSNQAPEEDLIIVKVEEDQGWDQESNLHDNNPPGQELFRVRFRQLCYQ
ETLGPREALIQLRALCHQWLRPDLNTKEQILELLVLEQFLTILPKELQTLVKEHQLESGE
EVVTLLEDLERQIDILGRPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXTSASXXXXXXXXXXXXXXXXXXXXXXXXXXTLEKIEDMAVSLIREEWLLDPSQ
RDRCRDNRPEKYRAMFSLGGETRNENRELASKQVISAGIQPLGETDAKCNGDVIRGLEHG
EAQDLLGKLERQRGNPTQERRHKCDECGKSFAQSSGLVRHWRIHTGEKPYQCNVCGKAFS
YRSALLSHQDIHNKVKRYHCKECGKAFSQNTGLILHQRIHTGEKPYQCNQCGKAFSQSAG
LILHQRIHSGERPYECNECGKAFSHSSHLIGHQRIHTGEKPYECDECGKTFRRSSHLIGH
QRSHTGEKPYKCNECGRAFSQKSGLIEHQRIHTGERPYKCKECGKAFNGNTGLIQHLRIH
TGEKPYQCNECGKAFIQRSSLIRHQRIHSGEKSESIGV
Download sequence
Identical sequences ENSPCAP00000015300 ENSPCAP00000015300

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]