SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000015591 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000015591
Domain Number 1 Region: 69-116
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000353
Family TSP-1 type 1 repeat 0.0033
Further Details:      
 
Domain Number 2 Region: 30-71
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000000575
Family Somatomedin B domain 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000015591   Gene: ENSPCAG00000016686   Transcript: ENSPCAT00000016655
Sequence length 259
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_5332:8993:45950:-1 gene:ENSPCAG00000016686 transcript:ENSPCAT00000016655 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LALCALSRLWPGTLAGCTEAGRCCPGRDPACFTHGWRLDRVYGTCFCDQACLLTGDCCFD
YARACPARPCVVGEWSPWSSCADQCRPTARVRRRSVRQQPQNGGTPCPPLEERAGCLEYS
TPQGQDCGHTFVPAFITTSAFNKERTRQVASPQWSTDTEDPGYCMEFKTQSLTHHCAMEN
RPLTRWMQYLREGYTVCVDCQPPAMNSVSLRCSGDGLDSDGNQTLHWQAIGNPRCQGTWK
KVRRVDQCSCPAVHSFIFI
Download sequence
Identical sequences ENSPCAP00000015591 ENSPCAP00000015591

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]