SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPCAP00000015808 from Procavia capensis 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPCAP00000015808
Domain Number 1 Region: 783-831
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000103
Family Laminin-type module 0.0065
Further Details:      
 
Domain Number 2 Region: 877-929
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000053
Family Laminin-type module 0.0041
Further Details:      
 
Domain Number 3 Region: 831-879
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000106
Family Laminin-type module 0.0054
Further Details:      
 
Domain Number 4 Region: 986-1036
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000179
Family Laminin-type module 0.0032
Further Details:      
 
Domain Number 5 Region: 521-562
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000026
Family Laminin-type module 0.011
Further Details:      
 
Domain Number 6 Region: 938-988
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000307
Family Laminin-type module 0.073
Further Details:      
 
Domain Number 7 Region: 282-336
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000691
Family Laminin-type module 0.028
Further Details:      
 
Domain Number 8 Region: 1094-1136
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000921
Family Laminin-type module 0.022
Further Details:      
 
Domain Number 9 Region: 1038-1091
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000586
Family Laminin-type module 0.003
Further Details:      
 
Domain Number 10 Region: 1142-1189
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000156
Family Laminin-type module 0.017
Further Details:      
 
Weak hits

Sequence:  ENSPCAP00000015808
Domain Number - Region: 1548-1672
Classification Level Classification E-value
Superfamily Prefoldin 0.00034
Family Prefoldin 0.0052
Further Details:      
 
Domain Number - Region: 1256-1337
Classification Level Classification E-value
Superfamily Methyl-accepting chemotaxis protein (MCP) signaling domain 0.0915
Family Methyl-accepting chemotaxis protein (MCP) signaling domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPCAP00000015808   Gene: ENSPCAG00000016825   Transcript: ENSPCAT00000016892
Sequence length 1796
Comment pep:known_by_projection genescaffold:proCap1:GeneScaffold_1032:6185:94086:-1 gene:ENSPCAG00000016825 transcript:ENSPCAT00000016892 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IYSAPPLVLLPAPAPTRSPIPPAALCGARVRAQEPEFSYGCAEGSCYPATGDLLIGRAQK
LSVTSTCGLHKPEPYCIVSHLQEDKKCFICNSQDPYHETLNPDSHLIENVVTTFAPNRLK
IWWQSENGVENVTIQLDLEAEFHFTHLIMTFKTFRPAAMLIERSSDFGKTWGVYRYFAYD
CESSFPGISTGPMKKVDDIICDSRYSDIEPSTEGEVIFRALDPAFRIEDPYSPRIQNLLK
ITNLRIKFVKLHTLGDNLLDSRMEIREKYYYAVYDMVVRGNCFCYGHASECAPVDEFYEE
VEGMVHGHCMCRHNTKGLNCELCMDFYHDLPWRPAEGRNSNACKXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXPENWGLSNDLDGCRPCDCDLGGALNNNCSAESGQC
ACRPHVIGRRCDEVESGYYFTTLDHYIYEAEEANFGPGVSIVERQXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLPDHWEKAVITVQRPGKIPASSRCGNTVPD
DDNQVVSLSPGSRYVVLPRPVCFEKGVNYTVRLELPQYTSSDSGVESPYTLIDSLVLMPY
CKSLDIFTIGGSGDGLVTNSAWETFQRYRCLENSKSVVKTPMTDCRXXXXXXXXXXXXXX
XXCECDPQGSLSSVCDPSGGQCQCRPNVVGRTCDRCAPGTFGFGPSGCRPCECHPQGSVS
AFCDPITGQCHCFQGVYTRQCDYCLPGYWGFPSCQPCQCNGHADDCDSVTGKCLSCQDYT
TGHNCERCLAGYYGDPVIGSGDHCRPCPCPDGPGSRRQFASSCYQDPVTLQLACICNPGY
IGSRCDGCASGFFGNPSDVGGVCQPCQCNHNIDTTDPEACDKETGRCLKCLYHTEGEHCQ
LCRFGYYGDAHQQECRKCVCNYLGSVQEHCNGSDCQCDKTTGQCLCLPNVIGQNCDRCAP
NTWRLASGTGCDLCNCDAAHSFGPSCNEFTGQCQCMPGFGGRTCSECQELFWGDPNVECR
ACDCDPRGIETPQCDQSTGQCVCIEGVEGSRCDKCTRGYSGVFPDCTPCHQCFALWDVII
AELTNRTHRFLEKAKALKISGVIGPYRWAVDSVEKKVNEIKDILAQNPAAEPLKNIGNLF
EEAEKLTKDVTEKIAQVELKLSEAASQSNNTARELDSLLTEVERLDDTVKELAEQLEFIK
NSDIQGALDSITKYFQMSLEAEARVNASTINPNSTVEQSTLTRGKVEDLMLERESQFREK
QEEQSRLLDELAGKLQSLDLSTIAEMTCGTPPGASCSETECGGPNCRTDEGQKKCGGPGC
GGLVTVAHNAWQKAMDFDQDVLSALAEVEQLSEMXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXDSADLDSIEAVANEVLKMELPSTPQQLQNLTEDIRER
VESLSQVEVILQQSAADIARAEMLLEEAKRASKSATDVKVTTDMVKEALEEAEKAQIAAE
KAIKQADEDIQGTQNLLTSIESETAASEETLYNASQRISELERNMEDLKRKAAQNAGEAE
YIEKVVYAVKQSADDVKKTLDGELDEKYKKVENLIAKKTEESADARRKAEMLQNEAKTLL
AQANSKLQVLKDLERKYEDNQKYLQDKAQELVRLEGEVRSLLRDISQKVAVYSTCL
Download sequence
Identical sequences ENSPCAP00000015808 ENSPCAP00000015808

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]