SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Volca1|101521|fgenesh4_pg.C_scaffold_2067000001 from Volvox carteri f. nagariensis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Volca1|101521|fgenesh4_pg.C_scaffold_2067000001
Domain Number 1 Region: 72-214
Classification Level Classification E-value
Superfamily Sortase 0.000000000000785
Family Sortase 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Volca1|101521|fgenesh4_pg.C_scaffold_2067000001
Sequence length 215
Sequence
MGALAAVAVLFLTACGTPTPSTAPSASSETSDSIPSVQQTQPSMPPAEPSAPPVEVKLRG
TTPTQPAATPPPVSLQVAGTSIDMGVVPVGVAPGGAMEIPETFYEAGWYRFGPAPGAAEG
SAVLAGHIDTTSDQAPFSQLKSLPAGTLITVGREGAPALNYRVVSVTLMAKDAFDGESLF
RRTGPHELKVVTCGGRWLDERMDYSDNVIVTAVLE
Download sequence
Identical sequences D8UMX4
jgi|Volca1|101521|fgenesh4_pg.C_scaffold_2067000001 XP_002960010.1.37214

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]