SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Volca1|103701|estExt_fgenesh4_pg.C_80201 from Volvox carteri f. nagariensis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Volca1|103701|estExt_fgenesh4_pg.C_80201
Domain Number 1 Region: 51-241
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 1.05e-37
Family PAPS reductase-like 0.004
Further Details:      
 
Domain Number 2 Region: 303-413
Classification Level Classification E-value
Superfamily Thioredoxin-like 8.91e-19
Family PDI-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Volca1|103701|estExt_fgenesh4_pg.C_80201
Sequence length 415
Sequence
MQLTQGHAFTARRAAAQPAARRAAVRTNVARVPQVNAAAVVTKPNWEALASEMQLSSPLV
IMDHALKTFGSDIAIAFSGAEDVALIEYAHLTGRPYRVFSLDTGRLNPETYRLFDAVEKR
YKIRIEYTFPEAQEVMDLVRAKGLFSFYEDGHNECCRIRKVKPLRKQLKTLRAWITGQRK
DQSPGTRTEVPVVQVDPVFEGVEGGPGSLIKYNPLSNITSAEVWNFLRVMDVPVNSLHSC
GYISIGCEPCTRPVLPNQAEREGRWWWEDAAAKECGLHSGNIKKADGTTEARKAERDLWA
EGSAVATLSKDDVRALAEGKRAKGTLAVLYAPWCPFCQAMEPAYEALASQLAGSNVTVAK
YQADIDREFCNDNLQLKTFPTIVYLPPDSKQVIKYPSERRDVDTLVMWVKTVAGK
Download sequence
Identical sequences D8TNV4
jgi|Volca1|103701|estExt_fgenesh4_pg.C_80201 XP_002947921.1.37214 Vocar20014089m|PACid:23134211

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]