SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Volca1|104718|estExt_fgenesh4_pg.C_180184 from Volvox carteri f. nagariensis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Volca1|104718|estExt_fgenesh4_pg.C_180184
Domain Number 1 Region: 211-437
Classification Level Classification E-value
Superfamily Argininosuccinate synthetase, C-terminal domain 9.94e-90
Family Argininosuccinate synthetase, C-terminal domain 0.0000000897
Further Details:      
 
Domain Number 2 Region: 40-203
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 3.09e-50
Family N-type ATP pyrophosphatases 0.000000892
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Volca1|104718|estExt_fgenesh4_pg.C_180184
Sequence length 440
Sequence
MLGLKLNQRCAGSRAKPTPVPARGRKACVSVQAAASGKVKKVVLAYSGGLDTSIILKWLQ
DTYGCEVVTFTADLGQGEELEPARAKAEKMGVKQIFIDDLREEFVRDYVFPMFRANALYE
GTYLLGTSIARPLIAKRQIEIAKEVGADAVSHGATGKGNDQVRFEVGYYSLKPDIKVIAP
WREWDLLSRTKLIEYAETNGIPVPQKKRGEPPYSMDANLLHISYEGNALEDPWVAPEESM
FTRSVSPEQAPDQPTTIELEFEGGNPVAIDGVRMSPATLLTKLNELGGANGIGRVDLVES
RFVGMKSRGVYETPGGTILQVAHRAMESITLDRAELHLKDDLMPRYAELVYNGFWFSPER
EALQALVDKTQQFCTGAVRVKLYKGNVQVSGRKSPFSLYDKVIASFEDDKGLYNQADAGG
FIKLQALRLRTLGVNRYKML
Download sequence
Identical sequences D8TV86
XP_002950332.1.37214 Vocar20005531m|PACid:23135368 jgi|Volca1|104718|estExt_fgenesh4_pg.C_180184

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]