SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Volca1|105065|estExt_fgenesh4_pg.C_230055 from Volvox carteri f. nagariensis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Volca1|105065|estExt_fgenesh4_pg.C_230055
Domain Number 1 Region: 592-705,736-874
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 5.95e-31
Family N-type ATP pyrophosphatases 0.03
Further Details:      
 
Weak hits

Sequence:  jgi|Volca1|105065|estExt_fgenesh4_pg.C_230055
Domain Number - Region: 298-354
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 0.0027
Family Class II glutamine amidotransferases 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Volca1|105065|estExt_fgenesh4_pg.C_230055
Sequence length 961
Sequence
MDFPKTVEEIFEDYQRRRSGLLRALTDDLEELYQQADPERENLCLYGTREGTWAVELPAD
EVPPELPEPCLGINFARDGMAKRDWVALVAVHSDSWLLAVAFFYAVKLDAAGRMRLFKLI
NTMPTLFESVSQRNKYSKSSAPQPQPGPVVKKKKFEDRPVESKYPSGRLLKADDVSPALK
GRQAELFWPDNQLWYLVEIISVNAKTKQAKIVYASVVGVAAPGLRVAEMGDWGQVVVPGA
ACRLHFFASLLQLRGLVPRTSPCVSSQGHILCFNAPTPVYLPRCRSAGELFGGLEVPPGE
NDGACLLAALAASASSTASTSSVPQVLSQLRGPWALLFWDPSRQQLWFGRDALGGVVSCG
SEGGWQLGTAGGDAAAGTAPPGGGGGSAADGEDAEPSGCDGYWTEMPPGLYGISFAVQGS
GPDGSNWNAMMGPEGGEGRGGVSPCGEPVGSPSARPLRRRLVMVGSRGLSLERYDWHDPL
LRQLESYCRTESSLLRQQAPVDTSVAVATAAAVAVASEGEEGEAVREVYGGGSGGEAEVL
AVAVADNAAAVAAAVRPHGASDESVAAEAEAAGRGHPRSSATAVGEAGAWRDAPVMILFS
GGVDSVLLAALAHRVLPLEVPIDLSNVCFAGGGSPSPDREAARDALEELASSCPGRCWRL
VEVNASLRDVDRHRSRLLALLRPAHTVMDLNIGAALWLAASGQGSLRLPSAATAANGGAP
ESLMPAPGALYGSAARVVLLGHGADEQCGGYGRHRTRFRSGGWVGLSQELEVDVRRLWLR
NLGRDDRLVADWGREGRHPFLDEDVMRFLLQAPLEHIVDLRQPPGQGDKRLLRRALVLLG
LPRAAARVKRAIQFGSRIGKVSNTRDFGSNRQANRRNAGSVALQDLTTSGEQQLPRAHNE
GAGGTQLPSRAHIAPSYDTGDLHSGTCATEMVDSIIIYKRVGQCDCATVTPPILLTSSYH
S
Download sequence
Identical sequences D8TY52
XP_002951313.1.37214 jgi|Volca1|105065|estExt_fgenesh4_pg.C_230055

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]