SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Volca1|105406|estExt_fgenesh4_pg.C_280088 from Volvox carteri f. nagariensis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Volca1|105406|estExt_fgenesh4_pg.C_280088
Domain Number 1 Region: 7-147
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 0.00000000000000109
Family Universal stress protein-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Volca1|105406|estExt_fgenesh4_pg.C_280088
Sequence length 208
Sequence
MRETRSDDTDDSQKSWDWIINNFYRDGDEVHLLNVISRLTFAATLGVPAVDFTPQINREA
YEKAVQKAEAFIVKRFLARLPESIQTTPIVHIIKSEVDTNSVGHVICMKADELKATCILM
GSHNKGPVAEFFMGSVSQEVCCKRKLPACWGSELRAGIVVSQVNYIPGHRRSSTRGTIPF
TIGKGFDPNGYPGISRGQWSRVTSSAKP
Download sequence
Identical sequences D8U0M2
XP_002952273.1.37214 jgi|Volca1|105406|estExt_fgenesh4_pg.C_280088

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]