SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Volca1|105972|estExt_fgenesh4_pg.C_360129 from Volvox carteri f. nagariensis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Volca1|105972|estExt_fgenesh4_pg.C_360129
Domain Number 1 Region: 31-161
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 5.68e-17
Family N-type ATP pyrophosphatases 0.033
Further Details:      
 
Domain Number 2 Region: 223-290
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 0.0000000046
Family N-type ATP pyrophosphatases 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Volca1|105972|estExt_fgenesh4_pg.C_360129
Sequence length 300
Sequence
MTVLHLMRMPEVALEAIGNDDAWREDVQARLAKVEDCEVVLLVTFVPAGRKQSFKAHPLE
VVQLQARALGLPHAVLEISSAPTFLDSYRANINHLREQYGITALATGDILDVCNSFMPRA
AAGTGVDLICPLWGIERGLLLELIWAYGMKPLITCVNVTKFEPAAQRATAAMAVQLSAAQ
QAGFTLSGGEMQLGACGGGFGGSGAGVDGGGLASGIGMRVGDGTALLGRQLDRDLYNEAL
LPAKEVYGVDECGEWGEFHTMVTDSRLFGGGPLRLSFKCLREGDYAFLSLSASEERTDAS
Download sequence
Identical sequences D8U421
Vocar20007568m|PACid:23128676 jgi|Volca1|105972|estExt_fgenesh4_pg.C_360129 XP_002953449.1.37214

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]