SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Volca1|106052|estExt_fgenesh4_pg.C_370091 from Volvox carteri f. nagariensis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Volca1|106052|estExt_fgenesh4_pg.C_370091
Domain Number 1 Region: 1341-1515
Classification Level Classification E-value
Superfamily Smc hinge domain 1.83e-25
Family Smc hinge domain 0.0057
Further Details:      
 
Domain Number 2 Region: 1800-1982
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.84e-22
Family ABC transporter ATPase domain-like 0.00061
Further Details:      
 
Domain Number 3 Region: 7-136
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 2.09e-17
Family Universal stress protein-like 0.03
Further Details:      
 
Weak hits

Sequence:  jgi|Volca1|106052|estExt_fgenesh4_pg.C_370091
Domain Number - Region: 448-496
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.000466
Family N-acetyl transferase, NAT 0.019
Further Details:      
 
Domain Number - Region: 1714-1829
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.0392
Family HBL-like 0.049
Further Details:      
 
Domain Number - Region: 1132-1367
Classification Level Classification E-value
Superfamily Tropomyosin 0.0654
Family Tropomyosin 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Volca1|106052|estExt_fgenesh4_pg.C_370091
Sequence length 2034
Sequence
MEGFPKRHILVAVDDSEASLRALDWALENLMRPGDEFHLFHVIPPGQYVVLSTDLGMEEV
IEDDEATKKRVEDNARKTLTEKFVPKLAAKEVPYQLELVRFATDNESIGAVICRRADQLQ
ASCVVMAKHNRGAIKAASYTEVRGMRGGNAVAPGFGSVATCLTCGMLYGKGLPEEERLHD
QFHNAHANAFKFSGWVSERVVLRDGTGSCGGRLLCVLPNDPKPQLRKVVEISGRLESVLG
VPQGYLLASKPPYKVFMWASGSGGGAGGGAGSSGGSGGRGRIVGVLVAQLQQRASSAPGT
STGRKARASERCGAAAVVETEVKRPRLGGGAVTRVSTVGEVPDSCGGAGRTVGRPIAEAV
PATTTATAVPADGLAPATPCYTVSGAAGGGGGGGCSSGDGYAKAAAKGAQASPAASSQAA
VAAHEVTRTCASAAEAAAVAAVVALPHHRACVGDGGSGGEARVGELARVVIGVRGLWVEP
GWRRRGVARRLLDAARCCMVPGVAADRTGVSFSACAVAAVSGDNDGGGAFAAFAAAYLGS
GGSACLASQDADPLEAHPVRRAFLSVGVTANDLSRASRLEPSLLNYTTDRLHAIIDLLLN
LGLTGSDIGKVLIAFPQAFQLSLDHHAQPVIEFLLGDMGLSPAQVRTLVTRFPAILGMNV
KGQLRPQLAFLTSLGFSSESLPELVLSRPLVLGPGIETVISFLRRCGVPRSQMHRLLRSY
PLDYKVRLTGLSAASSNWGSGSSSSGGSSSSGGGSPPGLTIHYCVMAGALFGCAVRGLPG
WYQAVMAVLLAVSLVLLWLTHLMDPGIIPPRSEKDPLIEALESGRDDEVPHKERYTKTLQ
GTWVRTLTVAEWAEEQRQNPSRHPSLGSRHRMKRQAAGGSTGAEARVEVAWTQKSPPMEG
QEAQEPLTQRPSLPPPPPAQQQQQLPGAGCDNGDSSIMEQGRAALTRGPVGDSVSPGLRN
AAAMHVGRVAAAPPGNGNGGVGAVASTAASSSRPPLSRAAAASMVIHKYCVTCNIWRPER
AHHCRVCGYCMDHFDHHCGTMGNCIARLNHRFFASFMVLAQLLKTQLEPSLLDLRKKCES
YNEYTSLQSARDRLLRFCLAYDHVSCTRTIATGDDEIAAMEEAMAAKGKEQDERQQDYND
LVAQARDLATEKEIKMGGEMRELKKTVDGLQLKLSGSTTALKHKKDALKADQAALKQLQA
QAAELTAQDLDGAVAAAEKRRDEARANLEAAEKAVEAATRELAGAEAGDGRDESNRSLQE
RLADAQVQQTAAEAEATEADLAVKHLTKQLSEQRKAAAAREKEGAGLAKELERHKAKVDE
CNARLQGLSFDEAAMKALEARRDASRGAVQRNRDLVKGLEGDVSGIRFDYTPPSRSFDAR
KVHGPVATLVRVKDPAAALALEVAAGGKLHQVAYPHMPPAVLEAAQRLGGGKARPAVDFL
QYDQRVAPAVHYAFGNVFICQDGGTAKRLAFSREVNMRCVSLEGDDFNPAGTLTGGSRGN
RLCLLAKLEELRAAQADLAQQMAELAEVDRQLGAMEAAARDYAKYTRELELAQHSLSLAQ
QRVAGSEAAQLVAAADATEAQLAAAREAGAAAEKRKKELVEKAKALEHEIRNFDKDRGTR
IKAAQDKLKKAKSAAEAARKALRAAEVALAGAQAEREAAGGEAESLKKQIEAAQQSITGA
EAEVEKLSQEVAAANEAATAAASRLAGMQARLSECDGEIKALETSRDAMAKKMAECDQEM
KKLDAKIKMKQDTIAKSKDWIARMEAEYPWIATAKRHFGTGDYKFDGVDIGATRKEFEQL
RERCEALQGKVQASVVSKLQKNEEDYEALVSKRQVVESDKTKLEQVIEELDGQSRTALQD
VWTRVNTWFGQIFSTLLPGTSAKLEPPEGGTYLDGLEVRVAFGSVWKESLTELSGGQRSL
LALSLILALCRFKPAPIYILDEVDAALDLNHTQNIGRMIRENFPESQFIVVSLKEGMFSN
ANVLFRTKFVEGVSTVTRTITDTGRQAAAGAGAKAGTAQGRARTGASTLQNSNR
Download sequence
Identical sequences D8U4S8
jgi|Volca1|106052|estExt_fgenesh4_pg.C_370091 XP_002953705.1.37214

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]