SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Volca1|106533|estExt_fgenesh4_pg.C_450084 from Volvox carteri f. nagariensis

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Volca1|106533|estExt_fgenesh4_pg.C_450084
Domain Number - Region: 252-297
Classification Level Classification E-value
Superfamily Photosystem I reaction center subunit XI, PsaL 0.00523
Family Photosystem I reaction center subunit XI, PsaL 0.0099
Further Details:      
 
Domain Number - Region: 162-246
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 0.0209
Family Universal stress protein-like 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Volca1|106533|estExt_fgenesh4_pg.C_450084
Sequence length 309
Sequence
MKMCAASLALFLLLLAAVVNAENLGISAPVMAWSNRAVFAKGKHVSYEVFPDVEQVATDL
VLGVLGKAEASDFGVHGLSGEALSSEEPRTVVAFIGSQLDAADMRSRSDAVRSLDDVLSG
AVSSLALPYSISKGDSIHETLCTKLDSAGIQHEVVGCSGPSTDIKLDVAAALAKGSNAKL
HVVLVCSQIEDAQKGTNAGLSSEVEQLMAVQAAVKEANVNHVLVYATETMPTTDLLANGS
KRRSLLAPLTGFGPYTTCGPLCQTQVRWLEGMLAVLFLALASCAGLVCLYVLDTPTRFEA
PNKDAAPQQ
Download sequence
Identical sequences D8U7V0
jgi|Volca1|106533|estExt_fgenesh4_pg.C_450084 Vocar20010371m|PACid:23136507 XP_002954750.1.37214

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]