SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Volca1|106960|estExt_fgenesh4_pg.C_550009 from Volvox carteri f. nagariensis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Volca1|106960|estExt_fgenesh4_pg.C_550009
Domain Number 1 Region: 1138-1307
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.75e-37
Family Pancreatic carboxypeptidases 0.015
Further Details:      
 
Domain Number 2 Region: 13-205
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 2.77e-16
Family N-type ATP pyrophosphatases 0.0059
Further Details:      
 
Weak hits

Sequence:  jgi|Volca1|106960|estExt_fgenesh4_pg.C_550009
Domain Number - Region: 281-443
Classification Level Classification E-value
Superfamily ARM repeat 0.0109
Family Armadillo repeat 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Volca1|106960|estExt_fgenesh4_pg.C_550009
Sequence length 1503
Sequence
MKQLLRDLFTLDATDLPYATASAAAAGLDHIVVRISLDDLLHRHLPAVVRTLQSFDPMSL
RNDVAISCALHEAAARGFRCAATGDGADELLGGYSFTHRLEPAAWAAHRAHMARVMEFGS
SRLGPHHGVFVASPYTRPGFKAAALRLGKADCVQAQPDGSTLGKMPLREMFPNVTAAMRR
KDPIEVGCGTTALSKPGYFDHLISDEQFASERTYVMEHHKVEVRDKEHLHYYRIFRETFP
NGVVPGKPRHGSDPCPKCGCVFGIPQFHLLASKGDATIVAVVQEVLGFLAACSVQDVVSV
AIKVLEDGIALSPQAGTVLRLEGGLKQVIKHLKAALTLPAVAGPCARILAVTAGTSTVTQ
QALAKEKGLGQLLLNACALHVKDSAIAGPICEALAHIARAPKGASQLECENLLAVMQEML
VLYLGNWPVFGWVLKLLKNLAKHEYLQSGNTTFGGGAPGSGPASTARGAPGVLTCTGEGV
RLLLGVARVLARIPEQRKLLKRVSRTLWLLCPHLLTPLPPLEPLVPLPSKDAPHLNIASA
AETDSQRHQELFPEEYPWQQLPLPQANQLQQQTPGNGVGPGWSSQLAQGSFTVRPTGSLP
ARPPSARQTCRSIAAMNGMGGAGGGGGGGGAQVDVGPGTGPGLGLGQTPEPFHGYGTSLD
CEMMLHDLQRIANPRGLVNRVVYMNISASSGPPPLGGSAMPPFGVRESQPLQPTLRSALQ
PTDQVTWLPEAAAAGRGSDGRPTSGTFPELARVAPGDAGDGGSNGVQQGLSLASRTASSP
ELDPFHLPNINADPWGRGDGSGTGGLQALLRSSGRSAPVAIGPLSSATVGIGGGPRPQSP
SPPSLSFHSNFESGNLRCATQVGPREYDLFLSPDLNDRSEGGNLCQWFYFAVTVPPGACS
GSGWPQQGQACRGGGGAGATAQFYQQQAELPASLESAAAAAGGSNSSNSSNNITLSPGTG
LGQGPGIKMNIVNLRKKESLFSGGKRPVMCLARPATVDGEPSMTTPRSRPGSAPSPVTDP
GVWLRAGTHISYYPSPYRGRPTVAGEGAASRKGKKPSAAAAAAAAAAASPGATGNGAATG
ASAAAATQSSGKRTKVKSKANAIADGADGDGGSAFSTTAIGPGLYCASFTLHFPVPGTYY
VASCYPYTYSDLQAVRQRECIFITSRVHPGETCASWLMQGILEFLCSSDPAAVTLRNSFV
FKLVPMLNPDGVVNGNYRCSLAGVDLNRVWDRPFRCLYPTVYHSKRVLQQLAAAGRLALY
IDIHGHSTKSDTFFYGCEPSAAALAAQGKAAPAAIYASPSARYATGGVDGEAQLLPQQQQ
QQQQPMLPGCGNGTGGGTTIAGGLSVQGNGFGGGVGAGYAGGCAWPYGNGGPQQTSAASA
TMAPPASGPTPRVAARLRVRMLPYLTARISSDFSFAKCSFKIRKRTQAKLSAARVVVHRE
LGVAGSYTLEASLAGSSTSANHFSARDYLAMGHNLCRAICELAEVDDAALLEEMNARVTL
PPM
Download sequence
Identical sequences D8UAX7
jgi|Volca1|106960|estExt_fgenesh4_pg.C_550009 XP_002955810.1.37214

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]