SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Volca1|107074|estExt_fgenesh4_pg.C_570089 from Volvox carteri f. nagariensis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Volca1|107074|estExt_fgenesh4_pg.C_570089
Domain Number 1 Region: 37-166
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 0.000000000000226
Family Universal stress protein-like 0.017
Further Details:      
 
Domain Number 2 Region: 196-319
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 0.00000000000603
Family Universal stress protein-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Volca1|107074|estExt_fgenesh4_pg.C_570089
Sequence length 351
Sequence
MDAQTGNMEDEFNAMAPSTVEVVMGEVKKRLGSALSIACAVDGSQMSDRAMAVGLSLFNN
RRGDKFTVIHISDATKTYLSKHLLPPHLKNYYIDMAHGARVTAEWLCREKEEGRSTCECL
TRLADKRGVELLIMGSWGRKGEKLDVLGTVSDFSLRQSHCSICIVRSTGSSIGGMAGGSG
GGAGVPAGIVSARPAKYLFATDGSHAAHLAFCFLVTYLYRPTDSIYVVMVTSSDGTEEAK
TVDMYKDYMSKHKINGAGYVKCIDRMTMTVPEGIVEAVTQYGCDVLVVGISGYGRKKLGS
VSTDISNRASCTTIIVKDSREIVRNRYTAAGSLSLATEMQVTPKTPQEDVI
Download sequence
Identical sequences D8UBU5
jgi|Volca1|107074|estExt_fgenesh4_pg.C_570089 XP_002956144.1.37214

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]