SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Volca1|109978|estExt_fgenesh4_kg.C_520007 from Volvox carteri f. nagariensis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Volca1|109978|estExt_fgenesh4_kg.C_520007
Domain Number 1 Region: 64-176
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 0.000000126
Family Universal stress protein-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Volca1|109978|estExt_fgenesh4_kg.C_520007
Sequence length 176
Sequence
MATLRCSLSLNTSAHLRKRDLRTVSAARGVCVRASAPEQESPVASAELQYNRVLLTILDA
NPFLSDGSRTAVATAALLARQHQSKVTVLVVDEPGTENTDPSRRLESISWHLKDRGCENF
EVVERAITSPASVLVGDVADEISADMVVLSSEAVHAKHVDANQLAEFVSCPVLLLP
Download sequence
Identical sequences D8UA94
jgi|Volca1|109978|estExt_fgenesh4_kg.C_520007 Vocar20005977m|PACid:23134957 XP_002955531.1.37214

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]