SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Volca1|115617|fgenesh5_synt.1__56 from Volvox carteri f. nagariensis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Volca1|115617|fgenesh5_synt.1__56
Domain Number 1 Region: 223-373
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 2.34e-19
Family Universal stress protein-like 0.016
Further Details:      
 
Weak hits

Sequence:  jgi|Volca1|115617|fgenesh5_synt.1__56
Domain Number - Region: 333-468
Classification Level Classification E-value
Superfamily ImpE-like 0.00157
Family ImpE-like 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Volca1|115617|fgenesh5_synt.1__56
Sequence length 518
Sequence
MAEPVRAFPWFVIGGQPRSIRSPPQPGPAAAVAGHRGVLPTAGYLHWRLRRRSGSSVVPP
LAATDPGGGGGGGGGTAEEARTGNKASRRRANPVPAPSSSPSSRNSASSNDADASRPPPT
GMSAGGGGRSQSERAATAAAEATVAETEAWRRQQQNPQTQPQSQLKSVSDFRTSDRIAEA
LNAAAAAATEEAPLHPHASGSIEVLRTHPHEFTCNEPNTCGGTILVALDDTDDAAAAVEW
VAKNLYHPGVDELRVVHVVCDPRTLQWQTSLGTTASGRSIADYLSRLQAAAGRVVDRRCE
QLHRGGVKYEVELPRLSACRSAAGIGETLLDAVRRYDAKLLVVASHGPGALAEYGSVSRF
CYQHSHVPLLLVPSIEAQAAAAAAAARRAAAVPLAPPPPPAAAAASSGALASEGAAAAAT
APAAAAASTRSEILLVVNHLEELASVWQWVADNCARKGDALSIWHVAGPSLSGMPSLSTA
IANQLQSRGLGQVSYRQLYSSTGDPQDLGDQVRHGGEG
Download sequence
Identical sequences D8TH74
jgi|Volca1|115617|fgenesh5_synt.1__56 XP_002946026.1.37214

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]