SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Volca1|116765|fgenesh5_synt.9__75 from Volvox carteri f. nagariensis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Volca1|116765|fgenesh5_synt.9__75
Domain Number 1 Region: 1316-1441
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 0.0000921
Family Universal stress protein-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Volca1|116765|fgenesh5_synt.9__75
Sequence length 1584
Sequence
MTVFVGPGRPPVARGESITAKLVFLEGALKHEQKRMKHVLQVMDDETQKREQQAQKVPQE
RLPDFILNTDFRAYERRRTEEQADAEGAGAQQQQQQQKDFSLLAKDPELRRKMMEQRKKM
LEYGKRVNVVKGAPGIKPLNLPAIKSKVAATWKPEEHGNHADEEDGGSEANLWASPQPAE
WRLRTHQARRRLFLLVGAIARWQLAMSRRPGPKRLPRVNSFSYFIPQESAVEPGLERVPP
VDLSPPHYHRKKQQPQQPAVEALAEVPERLRQGRGPPRRGVSDSGCPATAAAAAAAVAAV
DGEAAAAVAAGGGGDEARPKRKPELRKSSSGKCSSSSLPEALIPGHTSDVEAYGPPRRPC
SGRIASTRLPAIGSGRMSASGTGASDVNSPQLVPRQPRGKLGRIPSGGPRPGGGRTRRQS
DSSVAMAAAAAAGTALPATLAAGAATTIAPASPAAVIQRRGSAAVGVRSGAGWGSRGSDC
GSMQRQRELSDAGAAAVAAGGGGGPLPVGARVSMSGGMPGATGSPRRSVTGQLLALMSAG
SAPPDSPSCSGGGGGSGGGAGSNGGFLPRISSSNGVSGGGAGGQVPSPKPMTVAQARRLA
LLAEAGALVSGEDAAGRGNVAAASSPSRLGPLKLGNSGSGTPLGSGASRSPDKAASIAAA
AAALACAGGGASGGSILDALCQARDSTGAPSTTTASPLALPLAAGGMRELREAMALANGG
GGLPPGAPLSPMASPVALSSTSSDPPSNNSSGGGATSSILSSTTSTTISSSSAATAATTI
TTATSIATTTSSTSSAVAAAAAAAAVCTAAGPASAAGLPPLPPSKPPLGPAGCNVQPATA
AAAAAAALPPPPPSPPLLLDPEASARLSKAQQLMGMYANRERFCASDAWVPYKVTVLRML
KAGAMAVHIDACADAVQLPDGTSMDVWTSDPWNLAQRLRPGSLPLSERIEGVSLGARVLQ
QLVLAVESLAGRDAVPKLTVVLAINDDQRNAVVADIIRTRSYGLKPENLILTAQRKRCGY
RYDRDAQAFLEDPSTPAQVLGSGYSLCQLAWLGDAFSVTREGELAMLMARTLLERFAEQR
VEWLHLAFSLYAADRHGGNMVVQAAPAASLTIPRAYDSTLLTIKTPPGSAGATGLVPTRV
VSVAASAAGVESSGSANAVVVDLRAAELSSPVMVEVLAGVRKQAGHDGWVGLQRYLLHVP
TLHAMLNTLGIFRPKLFMAGDVARLSLDAADITADRRLACVAVHARNSPAILTSPNEVDD
LIPLLLAQDHSAAFRDIIAASSDMASLADAAAAAGGGGGDGARPAMVLMTTKPGIRILLY
IAANEVTQLAVNLVLLMARPGRDVVHLVTVVHNSLQMPSGQALLLKYLKQISNAMIEAHS
EVLVKGVNGLLEVMEGAASRLAPNLVVMASAALTMTNLNTASVMGSVTLSVLKRLTLPVA
VATSNCKNLVLTQRRTALRCMVLVDPTSRPALNFLCSSCMEPMRGDKLVLAGHHPTRQMT
TQQQQMQRRLIDNFGDISSSHRFHTPTKLQLDGPVDKALIAAAEDEAVHLVGLQVPLGTK
GVPGHVLGLIRSCRAGVMVFRDTA
Download sequence
Identical sequences D8TPB5
jgi|Volca1|116765|fgenesh5_synt.9__75 XP_002948185.1.37214 Vocar20001117m|PACid:23137988

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]