SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Volca1|117970|fgenesh5_synt.26__1 from Volvox carteri f. nagariensis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Volca1|117970|fgenesh5_synt.26__1
Domain Number 1 Region: 1400-1526
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 0.000000000142
Family Universal stress protein-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Volca1|117970|fgenesh5_synt.26__1
Sequence length 1602
Sequence
MGGAASKDFLENGPKNAVAKELDELGGYDRPALAKNQSFTARLDWLGNQVVKTSDQMEAA
LSKDEQAGRKELEKEAKRRQLMALRRGQGDVQMNLQYADFYLRQKMNERGTFNNSASILR
NSHIAALATEAVEISEASSAKLDAARRTAEQVATLQRLYSSKSGPGAVSQRAKPSPDSMA
GAAEGSGAAKGSGAAAASGGGNTKWRQTVQHAKKTAFLAVGTYVAMNQLGEGVQKFVEEG
ERLAAARDKLPDMKAELENLRSAMQQLAAEQQALEASCPPEALDSHDGDGDGDAAAVAAA
AAAAGVSSDAEAAALDDDGLDADEAAATAAAAMAAMRHPGHKASSPNKPRWHYSGASPGF
DSAGYPRAKPGTRLRDAPASAPPGRRNSNSAGGSLSLQSAPLASALPTVGYLGPPPAFSA
ARRRATTPSSASGAAAAAAATPLLANGSPPLQGGGGGAGLTPRGRTSLARASWSGAFSQP
DPPATPGGGGSGGGSTSAGELLLPLSGQQTHGAPLRPSRPSAPGSLRLSAPSGTGVRCRS
EPVPAATAAAAAAAAGGAGGGGGAGGLLRPASPVRPSLLGMGPRPPSCGGSPVLAGRPGP
PGPQRASDTYRPVLGNEAPSTPGEHRVGTMAQRIASKIALPLRAARHQLRSLRDAETANV
LRQQQLLASIEENAAILQSTSGMLNMYCNRANGRWVEAQQWAMPPVHEAALPGLRQQAAR
YKDVVLRDIKDGRLAVQIHVDDDIFMSARLGPLAMWSVDPWQLLAVTHPTRTEWTSHLVG
LGLGVRQLLALATAVESLAGTEAVGKMQVVLSCHEGQVEAVVRDLTARKMCRFSPDNVII
SVQQRAPGHAYDKVKRTFAPAPQAPPRAAGSGYALLALCWAGSEAFRLGGADLSERRPLD
RSALDTFLEKEVTWLSSWRLRDLVHYSPENCLNIEQLALSYALSDSMDANMSMQVELIES
LHGISRYGSGIVLSLKERALSAVPPPAPAAVAANVPLLRRTNGRTGPHGSGPATSSTSAT
SSSYAATSSSSSAPSTSSTSTSSSASTSVDSAHTALTGPSTPPLAQPQPPSQPPSVQAPL
RPLHIPPQRQPLSAPPSPPLTGAPKSGSPRCSLDKSGSGGSAAGGGGGRGGASSSRRSLA
SSGSAGRAGGIGGEGGPLSVCDIKWADVQTPALAAGLQQLVDTAAQQNGTTPRVPVSIKR
YMYHVPSLRAVLSGPSIFRPSVSIGEGGYLYVTFDASDITAQPAARCVALSFGSRGSATT
GPGGAAAGNTGNTGIDGGSLPPARLSSAGGAGAGSGATASAAASAAGAASPAGAGNNSLT
LATAQSAQSALQRGRLLTNDSDLDTLLWVMGEQDNHPGFRASVSATNTARSRVVSHAGAG
VVGGSVLGGPGRGPLQQRVIVVAVTDDAACPLAVRVAMAVMKPGADCLHVLSIAKDPSSM
AVSAARGVAEKFESMAAATLGDVKSVVQVKRQSIVEDIAAYAELVRASLLVTGSMSLAAA
QGSSVVGSVALSLARDCNRPILVVKPNARQAESAYEVGKKLCLRAAVPAETGSRPMVRFV
VDHVLDGTRGDKLVLIRGKAFDKDMQELTSRFRSAGVPCPLS
Download sequence
Identical sequences D8TZK1
XP_002951922.1.37214 jgi|Volca1|117970|fgenesh5_synt.26__1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]