SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Volca1|120281|estExt_fgenesh5_synt.C_30051 from Volvox carteri f. nagariensis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Volca1|120281|estExt_fgenesh5_synt.C_30051
Domain Number 1 Region: 198-432
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 4.19e-49
Family N-type ATP pyrophosphatases 0.00000407
Further Details:      
 
Domain Number 2 Region: 12-210
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 5.57e-49
Family Class I glutamine amidotransferases (GAT) 0.0000274
Further Details:      
 
Domain Number 3 Region: 415-536
Classification Level Classification E-value
Superfamily GMP synthetase C-terminal dimerisation domain 1.7e-47
Family GMP synthetase C-terminal dimerisation domain 0.0000203
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Volca1|120281|estExt_fgenesh5_synt.C_30051
Sequence length 536
Sequence
MTANGTASHQAVVLILDYGSQYTQLITRRVRELCMFSMLFPGDASLDRIKSVSPRVVILS
GGPNSVHVEGSPRVPEGFFEYCGENNIPVLGICYGMQMITHLLGGEVKAAAHGGEYGRMP
MDIAASSRLFDFLSSSTVNVWMSHGDEAVQLPEGFTAVAKSHQGAIVAIENTERQIYGYQ
FHPEVMHTEHGMEMIKHFLIGIAQVPANWNMGQVLETQLQKIAEQVGPEEHAICALSGGV
DSTVAATLVHKVLGERLHCVFVDNGLLRYNEQQRVMDTFNNHLHLPVTCVDHSKVMLDRL
RGLTDPEAKRKAIGAEFIEVFKNYATELEQKLGKKPRFLVQGTLYPDVIESCPPPGSGQK
HSHTIKSHHNVGGLPKDLQFTLIEPFRELFKDEVRAVGRLLGVPEQFIKRHPFPGPGLAV
RVLGDVTEDGKLDTLREVDEIFVNTIREYGLYDEIWQAFAVFLPVKAVGVQGDQRTHSHV
VALRAVTSADGMTADWYSFTPAFLRDVSNRICNKVRTVNRVVYDITSKPPGTIEWE
Download sequence
Identical sequences D8TJ26
XP_002946538.1.37214 Vocar20009785m|PACid:23125146 jgi|Volca1|120281|estExt_fgenesh5_synt.C_30051

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]