SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Volca1|120852|estExt_fgenesh5_synt.C_180020 from Volvox carteri f. nagariensis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Volca1|120852|estExt_fgenesh5_synt.C_180020
Domain Number 1 Region: 237-356
Classification Level Classification E-value
Superfamily DHS-like NAD/FAD-binding domain 5.45e-46
Family C-terminal domain of the electron transfer flavoprotein alpha subunit 0.00000784
Further Details:      
 
Domain Number 2 Region: 28-198
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 5.37e-39
Family ETFP subunits 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Volca1|120852|estExt_fgenesh5_synt.C_180020
Sequence length 367
Sequence
MLSAAIRQGQQRCTAGWHFIASSSRQASTLLFVEHNGEGKVAPATLAAASAASQFLPGPL
EALVCGFGEALASTAASVAAVPGVTKVWLASDPSLERPVAEPLSKLLSRIAAKHQPSHLL
AASTAQGRNLLPRTAALLGTQPVTDVVKILDENTFVRPIYAGNAFATVQFSTPPPAVRVV
SVRPTAFAAGAAAAASSPPAGASPAPVEPVAPELLHELGDVVSARWEGQDVRSSGRPELG
SAKVVVCGGRALKSAENFAMLEELADQLGGAVGASRAAVDAGFVPNDLQVGQTGKVVAPD
LYIGVGISGAIQHLAGMKDSRTIVAINNDPEAPILSVADYGLVQDLFTAVPQLIKEVREI
KEQAGSA
Download sequence
Identical sequences D8TVK6
XP_002950271.1.37214 Vocar20005588m|PACid:23135253 jgi|Volca1|120852|estExt_fgenesh5_synt.C_180020

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]