SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Volca1|32944|gw1.104.9.1 from Volvox carteri f. nagariensis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Volca1|32944|gw1.104.9.1
Domain Number 1 Region: 1-219
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 1.57e-63
Family N-type ATP pyrophosphatases 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Volca1|32944|gw1.104.9.1
Sequence length 225
Sequence
MRVVALVSGGKDSCYSMQLCKQHGHDVVALANLLPEESAPDELDSFCFQTVGHQLIGAYA
ACMGIPLFRKRISGTSSVQDLGYTPTEGDEVEDLYQLLAYVKENVPGIQAVASGAIASDY
QRLRVENVCSRLNLVSLAYLWHQPQRLLLRGMVESGVEAILVKVACLGLHPRKHLGRTIA
AMEPALLSLADAYGCNVCGEGGEYETLTLDCPVFTRGSIVLDEFE
Download sequence
Identical sequences D8UJC8
jgi|Volca1|32944|gw1.104.9.1 XP_002958759.1.37214

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]