SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Volca1|64899|e_gw1.43.115.1 from Volvox carteri f. nagariensis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Volca1|64899|e_gw1.43.115.1
Domain Number 1 Region: 39-268
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 1.04e-52
Family PP-loop ATPase 0.018
Further Details:      
 
Weak hits

Sequence:  jgi|Volca1|64899|e_gw1.43.115.1
Domain Number - Region: 275-301
Classification Level Classification E-value
Superfamily Recombination protein RecR 0.0667
Family Recombination protein RecR 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Volca1|64899|e_gw1.43.115.1
Sequence length 455
Sequence
MAPRLCVRCQTSKAMLKRPKTQEQVCRECFFTLFEEEVHETISATKLFRPGERVAIAASG
GKDSTVLAHIMTTLNARYGYGLDLFLLSIDEGIAGYRDDSLETVKRNEQQYGIPLTVVSY
KDLYGWTMDEIVAQIGTKNNCTFCGVFRRQALDRGAVLAGANKIATGHNADDVAETVLLN
ILRGDVPRLSRCANIITGGDSPLPRVKPFKYAYEKEIVLYAYYKKLDYFSTECVYAPYAA
RGFAREFIKDLEAVRPMAIIDVIRSAEDFVFTSASEDKLPQPRNCERCGYISSQPVCKAC
VLLEGLNRGLPRLGVSRTRGKRGEKAGLHPDVERPLPPSASAARAELGPAGRADNTADGD
AGAAAAPASSSGRETGVHLDSGGIADDACVEKRTVGMRELEERIGGWGLGPGGDGIQGTN
SEGAGKDVAGVVGSSIRGARSVRKVQIEYELAEGT
Download sequence
Identical sequences D8U772
jgi|Volca1|64899|e_gw1.43.115.1 XP_002954480.1.37214 Vocar20006771m|PACid:23131854

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]