SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Volca1|89352|fgenesh4_pg.C_scaffold_12000113 from Volvox carteri f. nagariensis

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Volca1|89352|fgenesh4_pg.C_scaffold_12000113
Domain Number - Region: 84-146
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 0.0184
Family ETFP subunits 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Volca1|89352|fgenesh4_pg.C_scaffold_12000113
Sequence length 385
Sequence
MRVNGTATSKSIVVYVYSNYTVAADKPRVDILTSIIRSKIPGSLTMPMAKQPYFGDYTVG
YVIPSNKGSYFTLEQLGVKPPRVAALTAFVRRGGALVLLDGYDYTNKTNSLLPVIAAVLG
TDPLCRAIGVTSDLKQQRRISTGYFMNLDESIKVSRGLGLSNLNCETGKSIYSAIVNKTP
VAGAIFWPLGRGAVYWIGSSFQRPNLRGFQQVLVAALSTAVDAWKQGPPLSLAPRPPQPP
PPFSSIAVRSFNIVCTAAAFRNHFSPAAVTTSIRATPICNHAISTAEAISPTAPSTTTPS
SKSSSAITQAAVAVPGAPSIITGPPTTTTATPTITDVPSASNSAESSTDTTAATTTTATT
DIGSTSTAINATAIPTSVQSLQPTA
Download sequence
Identical sequences D8TRH4
XP_002949058.1.37214 jgi|Volca1|89352|fgenesh4_pg.C_scaffold_12000113

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]