SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Volca1|91774|fgenesh4_pg.C_scaffold_22000169 from Volvox carteri f. nagariensis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Volca1|91774|fgenesh4_pg.C_scaffold_22000169
Domain Number 1 Region: 386-536
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 0.0000109
Family Universal stress protein-like 0.026
Further Details:      
 
Weak hits

Sequence:  jgi|Volca1|91774|fgenesh4_pg.C_scaffold_22000169
Domain Number - Region: 9-132
Classification Level Classification E-value
Superfamily Nucleotide-diphospho-sugar transferases 0.0025
Family UDP-glucose pyrophosphorylase 0.013
Further Details:      
 
Domain Number - Region: 539-658
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 0.0402
Family Universal stress protein-like 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Volca1|91774|fgenesh4_pg.C_scaffold_22000169
Sequence length 697
Sequence
MHGLSLGCRYIASLVMALENIAGREAISRLPLVLVVNEDQQDEVVRQLWKYRFFGIPREN
VIVIVQPFHPGYSYDKTNRTWAYGDASHSLPLGSGYGLMQLVWREEALGVSEDGCLVALG
ESTFTWLENKGVNWMISRRSRDLGLLAKEGVLDVNALAYALHYHKDRAPYTNIVMEAALT
NSLLLARVLDRSFDTLIIHDSKNYIAPEAPCPPCPPRRLDAAAAGNDSSSSSPPHSYQAV
ELCSTDLSTPAMRAVLADYQATGKVLAGLGRYVMHLPSIQQAMLAGRLSVLRPKLCLVDD
LLHIRMEFADLTSAPNARSLLLQAQDNNNYFRQMVQSCRVDGCRRKTSVALASTSLLGAG
PGAGAARRSGMGLASVLSVPADPKAQTILVFVAANEVSMAAVEMAAAIAQPARDRVIIAT
VVSVDAQQSRQRGEDLLTKHGDEFCKLSPAKYICEIVERNALSLIDCMVDYAKRNATALV
ILGSNSITSQATTTSFATSSPYSTSATSSTATLIHIIGSVTLAMLRRLPMPLLLVTRQSA
AAAAAAAATSSSSKGGRRRELHVMAVLEGNAGTMIDYLAGRLCNQRAGDQLYFTYVKPTA
NLTQQQVGGIKALLSKHAHQASAYGMRPAKTCILDGPADRALAAAVKENAIDLMALPAAP
LAKQVPPSVVATLRAASTAVLWYRDPEPPEDLEEGDA
Download sequence
Identical sequences D8TXX4
Vocar20013346m|PACid:23130299 XP_002951268.1.37214 jgi|Volca1|91774|fgenesh4_pg.C_scaffold_22000169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]