SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Volca1|94176|fgenesh4_pg.C_scaffold_36000042 from Volvox carteri f. nagariensis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Volca1|94176|fgenesh4_pg.C_scaffold_36000042
Domain Number 1 Region: 1267-1367
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 0.00000109
Family Universal stress protein-like 0.035
Further Details:      
 
Weak hits

Sequence:  jgi|Volca1|94176|fgenesh4_pg.C_scaffold_36000042
Domain Number - Region: 1486-1613
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 0.00109
Family Universal stress protein-like 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Volca1|94176|fgenesh4_pg.C_scaffold_36000042
Sequence length 1649
Sequence
MKTVEEQSGLQRPPLRRGQSITNLDELVKKLTQEPIPLLTDSEDNNDLKAAIAKLSSGSI
LHTEKRAIERLLAQRYEDALAIAAAATSEQGGAEALGGASEVLRQVLVVFRQNNLPTELD
RSGLGEPAEWRVRTHEQRRRVFLVVRSMVRLKREVKRLSAPITDLGWLVPVAAQERWGEL
KALAARYRQLEGELLDTEVAVSQLAQLRDGNGKAPASSRNTAGGRASPQRALRSGPGRSG
GQGTGGRAVSESGAMNLRSKPRTALTADPPPPPIAGVRGGRRHGSVPESTSGGAGAGSQA
STPLLLPLTSPGSNSGMAALRTPLNGKKGGAGGSDGVVISSGGGAVGPSAATSALVPTIS
AQRSGSNSALSGLYSTRLSISGGSTTAGGVGAAGGILSGTVSLPPPNGVGSAAHARVSAP
GTGLGPAPPSSAAAVVPTVSPRFSQRDPTLSRSVATLGCTQMARQPFLTGDGGPVPSALP
RVAQILDLTTYNPNAPHNISVPLEPERRPSSVNTSTSAPVSMLLCNEQQTPLASPTTPTV
PRKPDTVPNGTGSAVQRSNGAGAGAGGGRPVEPSPPSAPPPIAGARRPLGPLSHSSPAPL
TMGAAAGAALAVVRSMGVTGHGDAAGAAPAAAPVGGAVAAPPSAAGPPVLIQDGESLEQA
LGRFKLLAEDTRNALVDTARQFRNVVDLCNSAWPDQRWWLAAHTQDDAALDTWPTSDEYV
VHRADMVRCLKAGAVAFQFMCYSDEPLVGPTGNRFDLWTSDPWEVAADLLGSDRLGEAQG
SPQRPSGERMVGLPLGVRVLQQLANSVAEAASPQALDLLPIILHISERQREVIAADLLQY
DIYRRLRKNLYIVVQRTHPVMRYSAADHAYLPASDQPEHTPGTGYSMLQLLWPGHALYVN
ESGELERLPHSIMQELRDRSTEWFVSRSGQDLSLLLEDGPLDMRSLAHISYMVKGERRGT
MPICGHQDCNCISLSVPSLSSVPCTPDPGLDLGGSVPLSTAVMSGFASRGRVAHVPGNPF
RMHDSPSHRAGNQGYGRWNTAHMRYSVVVEAASTYVKHRDMILQHGSVLLCRKPKVSGMV
VGRLDGAVRVDRYGGATKPQLPVVELLACELNSAHMQEELTQVATARATATSVGIGRQVR
GGLWRDGLETLYVPTPYLRHRVTLQAVYDDNAPGWSALTGGQANAMFPFPTPGGLNEQQL
SFAASQGLDTLLLRLHLSMTDLTMHHASKDGQKLVEVLVASDRDLSGAAERLAAKLPSFT
RQQKPGQNILVFVQDNSVSLTATNVAAGLVRRERGDRVHLVTVVPTEAQRSEGTGLMERL
LKAFRTHADVTTHVLSQDGRGLLECLGDVVTQQRCGLIVAGSTSITAVAVAAPRNVPLVL
PGVAPGKQPATAQGAGGTAGRGGGGVGAQGMQDDGSSEVLLSSVALSILRTFSLPVILVT
ANTRTYLKRHGLDPVAGGGRPARHPVGGVGGATSGRLAAMVVVERHSRPMMHHLARCLLE
PSLRQDTLTLVQVLPPGMAPGNPGYDPSSIHCVALKTLVANFESISAANDFHTPNKVFTQ
GEWYSALCIAARDYGAQLLSVQLAPGSTKSLPPLLLQLIRSAPCPVLVYPEKAIVPGASE
LTEGEHYIVCTACTLWAADLGLPGFAEPV
Download sequence
Identical sequences D8U4C3
Vocar20003859m|PACid:23137472 jgi|Volca1|94176|fgenesh4_pg.C_scaffold_36000042 XP_002953406.1.37214

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]