SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Volca1|99345|fgenesh4_pg.C_scaffold_86000013 from Volvox carteri f. nagariensis

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Volca1|99345|fgenesh4_pg.C_scaffold_86000013
Domain Number - Region: 1473-1569
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 0.0126
Family Universal stress protein-like 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Volca1|99345|fgenesh4_pg.C_scaffold_86000013
Sequence length 1789
Sequence
MHSVHSNANFKLNLQCTQRVTSSYPGVGSSSATERDHRPPYRLWWCCCGCKIEIRQECLL
KLVLDLQEAVHEQGNRLEEALAKDPLAGRHEIMRQEAMKLARSLNVNRHHFTVREWQTMK
HNDLRAQQAREELERRLQDRDKRDKSHESDQDRPAWNSLYWSQNDYVRRPQPKPEAVQQG
SSKPGSSPGSSPGRSKPAGARTAETEAEDEAAEATAAPARAGPIVPVPAGLLGAFPAAPS
ETGDDSEMPRVVRPLAAYRPGAEPAEWRLRILRAKRKAMMVISVVLAFRGRKYRARGLQR
LDSLSYFIAQHLGTDLERFVEEQGTYRVTRALAEEVWREKNHRDMPQSPMFDADPDESSD
PIPTVTFAGSSRGPLPSPAFKAPPSPQQQQQQRLPAGTSGGGGPSSTGPPGAGRAGSPLL
RSRPINLTPTLHHTQTAGAGATPALPTASSSGAGGAGSSRSALPAGAASGGGAAATAGTA
GVAAGGGAGTGSSSPLPVLRGQSERRSSGLVPPPGLEGESSAGTVAAGGNATVSLAGGKN
IRFSAPGSEVGPGAAGEDDGTVSTSDAVPALSPTAAAATAASGNGGKRWESPRFARRTGG
EFGEVKVRHSIGPTNASGISATVLRRPSAIAMLTDDTATVARARSWNGPPGGQPVPHARS
AGPDNTPSPPSPMGRQLRKHRESGLGLTGSASTTSLPQAGVAHPAVTRSPTASADGYIHA
PAAVTAAAARNKTSRYNGGGVVRIASATPSSGGGAAARRAGRVRGSAPGDGDRSVLRSVS
PYAERPRSVAGARALRCSSTIRRMVHDGSSDQLFLRYQEEAAALERPLRMMHLFANRANA
RWVEELAGSSSPPVSHSNSYNTLTAVGGTTAGNAAAVPSGPGWEPPHVYDGTRFSASVGA
AQASVFRAEVATMLRAGRMAVQVLAGEEYITMGDGQQQQALWDADPWDLIATTFPAKVAA
ADRVRHVHMGPRLLMALVAAVEALAGPEAVSRLVVVLHVNDAQKTEVVRELRFRKFCGLR
PENLVLVVQQRRPGYYWDPVQTIFVPDPNSPPVSAGSGYALMQLVWPEEALRVARDTPRT
SVVSKAEAPSWASAGGSATAAATAAAAAAVAEPPPLVPLGMSVLDFMAQRGIEWLLTRRL
RDINLYNPDLTLDSEVLSYMLYLHDHMGANIGLQVEVVDSLTAARAAQTGVVMAPPRQRR
TNSTGSGAAAAAAASALSSSMRLGAPLPPRRAATYTTGGGAGAGPGPGGGPYRAGSDVGA
VSQPEGGSVGAGPGGPLHPHMVVDVKNSDLGTPRTIQLLTELRTQAKGKLAVSTRRYLWR
VDVLQSLIQRSSIFHPSLEVAGDVAYLTFDMADLTAATEWGARCVAVSAGGRPIRNLNTL
SELEDLLIAVQAQDAHAPFRRLAGNVTPAFGLAHGATDSPHAPHAITLHPAVIGGGGGGA
AAGGQDPSASSPTSGAGVGPVADLRNIAPGQCIVILVAENESTSMAVQLVMALVKPGRDR
VVLVTVVPSVLQESAGRLLLRKHEMSIMKTMVDVSAQLLTKNPGSNLIDQLEAFIDDVGP
QLVVMGSQMLATSQGLAHGQAAAMSSSGGAGGGGGAGASLGSLGAIYSSGASFSGGAGGG
SHGGAGSTVLGSITVSMLRNLTRPMLIVKANAKFASLVWDKDKLRMLLEVHHSSRNMLRY
VCSKLVTPTRHDKIFLTRGGARDASQMEITTSRRLLENFSDIATQYKVSAVKRALEEPFE
SGAIKWAEHDKVHLIAVHAPAGRGLANSTFQILRAARSAVLVYKSNDPN
Download sequence
Identical sequences D8UHK8
XP_002958136.1.37214 Vocar20008407m|PACid:23125982 jgi|Volca1|99345|fgenesh4_pg.C_scaffold_86000013

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]