SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Volca1|99481|fgenesh4_pg.C_scaffold_88000040 from Volvox carteri f. nagariensis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Volca1|99481|fgenesh4_pg.C_scaffold_88000040
Domain Number 1 Region: 20-192
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 3.7e-28
Family PAPS reductase-like 0.051
Further Details:      
 
Domain Number 2 Region: 338-431,486-573
Classification Level Classification E-value
Superfamily Molybdenum cofactor biosynthesis proteins 3.37e-27
Family MogA-like 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Volca1|99481|fgenesh4_pg.C_scaffold_88000040
Sequence length 632
Sequence
MDILQQIDSIPDPVVADKACKAVQVLRRTCALYPLDKIAFSFNGGKDSTVLLHLLRAAVA
QLENCTDLGGLGGIKSFYFCNDDDFPEVKDFVQRTDAECVQSVGYGLCVEYLRLSDFKRG
LCEYLDRTGVMAIVLGTRRGDPNGGNQDCFCPSSDGWPPFMRVNPIIDWTYHDVWVFLRA
THVPYCSLYDHGYTSLGGTGNTLPNSALRSSDGSYEPAYKLADGRLERVGRVHPATHKQA
ATRHSHLHPRTPLASSKCPGAVPGQEDSTHPQKAQIEGQQQTDGLGEEGTEEEGDARRGG
GGAGGDGAAREAGSSLATSGGGGAAGGGGGGGGGLTHSAAIVIIGDELLSGKVEDVNARF
LCRELRSLGWQVTRVVFVPDDVDEIASAVRALAAVVQLVITAGGIGPTLDDVTMQASRCG
VRGQGGEQRNVLVSLSLPLAALLTAPAPPSLHSLVGIARAVGQPLVRLPALVERLSSYFG
GPAALSEAHLKMAEAPQHTELIDYTLPYSDHVSKFPLMRVNNIYVLPGVPSLLVQKWNAL
KPRLQEAALAPFRNATLRLSVKDETTIAPALVRVASSHGLDVAVGSYPVDQGIIITLDSK
NSEKLEAAIAEIQQLLPGEAVVALERDVDSLA
Download sequence
Identical sequences D8UHW9
XP_002958238.1.37214 jgi|Volca1|99481|fgenesh4_pg.C_scaffold_88000040 Vocar20013505m|PACid:23137573

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]