SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for jgi|Volca1|96652|fgenesh4_pg.C_scaffold_54000024 from Volvox carteri f. nagariensis

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Volca1|96652|fgenesh4_pg.C_scaffold_54000024
Domain Number 1 Region: 1-258
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 4.54e-74
Family ETFP subunits 0.000000196
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Volca1|96652|fgenesh4_pg.C_scaffold_54000024
Sequence length 263
Sequence
MKVLVAIKRVIDYAVPVRVKPDKSGVEALIPKMSMNPFCEIALEEAVRLKEKGVAGEVVA
VSLGPQHFQETLRTALAMGADRAVHVSSEACGLSAQGGEQPQPLGVARVLAALAKRENAG
LVLLGKQAIDDDCNQTGQMVAGLLGWPQATFASKLEAAKGDPRVRVTREVDGGLEVLSLP
LPAVVSADLRLNTPRFVTLPAMMRAKKRPIESATLEQLGLSAADVAPQLRTVVVEEPPRR
KAGSRVADVGELVRRLREEARVL
Download sequence
Identical sequences D8UAP4
jgi|Volca1|96652|fgenesh4_pg.C_scaffold_54000024 Vocar20006415m|PACid:23128420 XP_002955715.1.37214

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]