SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|28901414|ref|NP_801069.1| from Vibrio parahaemolyticus RIMD 2210633

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|28901414|ref|NP_801069.1|
Domain Number 1 Region: 28-142
Classification Level Classification E-value
Superfamily PH domain-like 6.15e-40
Family BPHL domain 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|28901414|ref|NP_801069.1|
Sequence length 143
Comment hypothetical protein VPA1559 [Vibrio parahaemolyticus RIMD 2210633]
Sequence
MWSDTLRNSFFSLFKGRLMIDFDNSSVFKLKPIDVSKVRDDFHKFLIDGETIFTAFKTVR
DQVVFTNKRVIAANVQGITGSKVDYTSLPYSKINAFSIETSGTFDLDCEIEFFLSEVGRV
RFEIKGSFDLVAFNRMISERVLD
Download sequence
Identical sequences A0A0F6LK16 A0A2H1B196 Q87FW9
gi|28901414|ref|NP_801069.1| 223926.VPA1559 NP_801069.1.6614 WP_011106535.1.10142 WP_011106535.1.101585 WP_011106535.1.10999 WP_011106535.1.11352 WP_011106535.1.12087 WP_011106535.1.130 WP_011106535.1.14243 WP_011106535.1.15211 WP_011106535.1.16073 WP_011106535.1.16176 WP_011106535.1.16503 WP_011106535.1.16742 WP_011106535.1.1836 WP_011106535.1.19074 WP_011106535.1.19755 WP_011106535.1.20587 WP_011106535.1.21130 WP_011106535.1.22008 WP_011106535.1.22854 WP_011106535.1.22951 WP_011106535.1.24866 WP_011106535.1.25390 WP_011106535.1.26080 WP_011106535.1.26245 WP_011106535.1.264 WP_011106535.1.26729 WP_011106535.1.27000 WP_011106535.1.29832 WP_011106535.1.29928 WP_011106535.1.31998 WP_011106535.1.35351 WP_011106535.1.35596 WP_011106535.1.35751 WP_011106535.1.36788 WP_011106535.1.37148 WP_011106535.1.37683 WP_011106535.1.38010 WP_011106535.1.39 WP_011106535.1.39142 WP_011106535.1.39379 WP_011106535.1.3961 WP_011106535.1.39756 WP_011106535.1.39842 WP_011106535.1.40049 WP_011106535.1.42776 WP_011106535.1.42858 WP_011106535.1.43185 WP_011106535.1.43895 WP_011106535.1.4519 WP_011106535.1.45633 WP_011106535.1.46057 WP_011106535.1.4734 WP_011106535.1.47510 WP_011106535.1.48035 WP_011106535.1.4861 WP_011106535.1.48612 WP_011106535.1.4902 WP_011106535.1.49432 WP_011106535.1.49920 WP_011106535.1.5033 WP_011106535.1.50640 WP_011106535.1.50833 WP_011106535.1.51827 WP_011106535.1.51945 WP_011106535.1.52959 WP_011106535.1.53064 WP_011106535.1.53207 WP_011106535.1.53943 WP_011106535.1.54059 WP_011106535.1.5410 WP_011106535.1.55108 WP_011106535.1.55354 WP_011106535.1.5595 WP_011106535.1.56068 WP_011106535.1.56836 WP_011106535.1.56842 WP_011106535.1.57128 WP_011106535.1.57129 WP_011106535.1.57332 WP_011106535.1.5768 WP_011106535.1.58791 WP_011106535.1.5962 WP_011106535.1.59786 WP_011106535.1.59887 WP_011106535.1.60089 WP_011106535.1.60172 WP_011106535.1.606 WP_011106535.1.61129 WP_011106535.1.61745 WP_011106535.1.62401 WP_011106535.1.6274 WP_011106535.1.63316 WP_011106535.1.63829 WP_011106535.1.6404 WP_011106535.1.65279 WP_011106535.1.66211 WP_011106535.1.66850 WP_011106535.1.67995 WP_011106535.1.71278 WP_011106535.1.71997 WP_011106535.1.73113 WP_011106535.1.73712 WP_011106535.1.74603 WP_011106535.1.74813 WP_011106535.1.75024 WP_011106535.1.75461 WP_011106535.1.77954 WP_011106535.1.78441 WP_011106535.1.79694 WP_011106535.1.81752 WP_011106535.1.81782 WP_011106535.1.81805 WP_011106535.1.81887 WP_011106535.1.82387 WP_011106535.1.82791 WP_011106535.1.83010 WP_011106535.1.83326 WP_011106535.1.83659 WP_011106535.1.8373 WP_011106535.1.84036 WP_011106535.1.84073 WP_011106535.1.86416 WP_011106535.1.86700 WP_011106535.1.8713 WP_011106535.1.88312 WP_011106535.1.88333 WP_011106535.1.90588 WP_011106535.1.91910 WP_011106535.1.92596 WP_011106535.1.92816 WP_011106535.1.93145 WP_011106535.1.93458 WP_011106535.1.94697 WP_011106535.1.95689 WP_011106535.1.96237 WP_011106535.1.96264 WP_011106535.1.9642 WP_011106535.1.96491 WP_011106535.1.99780 WP_011106535.1.99805

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]