SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000000063 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSPVAP00000000063
Domain Number - Region: 56-87
Classification Level Classification E-value
Superfamily Snake toxin-like 0.00527
Family Extracellular domain of cell surface receptors 0.075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000000063   Gene: ENSPVAG00000000066   Transcript: ENSPVAT00000000068
Sequence length 124
Comment pep:novel scaffold:pteVam1:scaffold_21936:6024:8255:1 gene:ENSPVAG00000000066 transcript:ENSPVAT00000000068 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVLAALLLALLLCRQPGRGRAQDEEDDGEGVEMESYDDDEDEDREAGDGGGELPRCFAC
QSLHSGEGCSQTQRCLLGQTVCTLISHGDTQGPQGSGAGSPLGAARLATALLLSLLPGLL
GAGS
Download sequence
Identical sequences ENSPVAP00000000063 ENSPVAP00000000063

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]