SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000000065 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000000065
Domain Number 1 Region: 812-1060
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 5.16e-83
Family Eukaryotic proteases 0.00023
Further Details:      
 
Domain Number 2 Region: 180-337
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.43e-32
Family Eukaryotic proteases 0.0016
Further Details:      
 
Domain Number 3 Region: 640-685
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 0.0000000518
Family Eukaryotic proteases 0.018
Further Details:      
 
Domain Number 4 Region: 153-192
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000113
Family LDL receptor-like module 0.0019
Further Details:      
 
Weak hits

Sequence:  ENSPVAP00000000065
Domain Number - Region: 417-438
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 0.0293
Family Eukaryotic proteases 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000000065   Gene: ENSPVAG00000000069   Transcript: ENSPVAT00000000070
Sequence length 1061
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_3279:4822:29569:1 gene:ENSPVAG00000000069 transcript:ENSPVAT00000000070 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPTVGESQLVPRAAKDVPPRDAVCCRVALCAAVAASIVIVTLAVLVASLSIQGVDVEHT
AELRGIRYSRSLQQEASDYYRMLTPTLEMLLHFLLLALRSLDLGLERELLQQGLRARLQG
HGIPLAAHGTLVSATLTGSQRGPLTERDLKSGRCPESAFSCGNGQCVTTVNPECDDKVDC
SDGSDEARCDCGSRPGLRTAGMIVGGVTSSLGEFPLQVTLRENGDHFCGAAIWVLDWQVY
ATYCXXXFQGPAEWVAYAGTTRLSGSEASAVRARVAQVITHPAYNADTADFDVAVLRLRS
PLPLSRHVQPVCLPAASHAFPPRSKCLISGWGYLREDFXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXSPG
VYARVTKLRDWILECISTASKPLSPTVAPAPATPSTAGPTSPESQVLGTPTQASLAPSSA
PVDSATTSKPPXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTKPDALQRASVGIIDQKACS
ALYNFSLTDRMLCAGFLEGQVDSCQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXCGLAPAAALTRIVGGSAAGRGEW
PWQVSLWLQRREHRCGAVLVAEKWLLSAAHCFDVYGDPKQWAAFLGTPFLSGADGRLERV
ARIYKHPFYNLYTLDYDVALLELAAPVRRSRLVRPICLPDPAPRPRDGTRCVITGWGSVR
EGGSMARQLQKAAVRLLGEQACRRYYPVQISSRMLCAGSPQGGVDSCSGDAGGPLACREP
SGRWVLTGVTSWGYGCGRPHFPGVYTRVAAVRGWIGQNIQE
Download sequence
Identical sequences ENSPVAP00000000065 ENSPVAP00000000065

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]