SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000000091 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000000091
Domain Number 1 Region: 346-530
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 7.83e-32
Family Prokaryotic proteases 0.0099
Further Details:      
 
Domain Number 2 Region: 25-54,183-287
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 0.0000000662
Family Prokaryotic proteases 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000000091   Gene: ENSPVAG00000000096   Transcript: ENSPVAT00000000096
Sequence length 565
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_566:56269:63134:-1 gene:ENSPVAG00000000096 transcript:ENSPVAT00000000096 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRQWGPAMRVAEQAGCVVRASRAGQPEAGSWSCSGVILSRSPGLVLCHGDIFTPFMRAG
SGVLTAAAAAFLPGDSCSDDLRVHVQWGPTASSPAGRAEWGRPGLCTPQCAGLEPIQPTP
YRGRPLKPPHPAELLLLLSCPAFREHFARLFGSEAAEQWRFASAAPDSEVSEDEEEDQLR
ALSWFALLRVQLDPEEEAVEHGKVLAVAPLGTVPKGAPLLACGSPFGAFCPDIFLNTVSG
GVLSNATGPLLLTDARCLPGTQGGGVFSARPPGALVALVAAPLCWKSREWVGLTLLCAAA
PLLRAARNALSRLRPSAASLASLLPPEVGAPWGLLLRDPGPPWAGAAVLVECGTVWGSGV
VVAPRLVVTCRHVAPRKASRVLVRPTTPKDAKIWGHVIFATQETSPYDIAVVSLEEDLEG
VPMPMPTEHFHEGEAVSVVGFGVFGQACGPSVTSGILSAVVQVDDTPVMLQTTCAVHGGS
SGGPLFSCSGDLLGIVASNTRDNNTGATYPHLNFSIPITVLQPALQQYSQAGDLSGLQEL
DHATEPVKVVWRLQRPLAETPRSKL
Download sequence
Identical sequences ENSPVAP00000000091 ENSPVAP00000000091

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]