SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000000191 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000000191
Domain Number 1 Region: 48-129
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 1.05e-21
Family SCAN domain 0.0025
Further Details:      
 
Domain Number 2 Region: 349-405
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.78e-20
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 3 Region: 310-362
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000489
Family Classic zinc finger, C2H2 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000000191   Gene: ENSPVAG00000000211   Transcript: ENSPVAT00000000210
Sequence length 434
Comment pep:known_by_projection scaffold:pteVam1:scaffold_25386:611:3086:-1 gene:ENSPVAG00000000211 transcript:ENSPVAT00000000210 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALDLRISCQGEPSWNDPGSENLELNTCQGPPIQEGEGISGSPSTELSLLSNSNNLCARQ
ELQRLYKSFHSWLQPEKHSKDEIISCLVLEQFMINRHCSERSTLKEKWNSSGRNLEKFME
DLSDDCIKPPGLVHVHMQGQEALFSENMPLREVIIHFAKQLSAGTSTAANMKIPSWTPQD
TSLETEQRDEDKENDGSISLETCQVNDSTTSQGHQIPSLLVIQEESCPRPEEGHVSVENL
LNSRRAGLSTSRSQEGSLKGPPYQDVLMEVGPVFLSRPDQVTPEPVPTHQSNVGNSTYGE
HQERFHRAQKSYQCDKCPKIFRYFSRLKIHQRRHNNERTFICAECNKGFFQASDLHVHQK
IHTGERPFRCGTCEMSFNHRTNLVAHERIHTGEKPYVCSLCQRSYRQSSTYHRHLRTHQR
LAFRCVSSAPEASS
Download sequence
Identical sequences ENSPVAP00000000191 ENSPVAP00000000191

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]