SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000000407 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000000407
Domain Number 1 Region: 402-567
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 1.31e-41
Family Integrin alpha N-terminal domain 0.00019
Further Details:      
 
Domain Number 2 Region: 95-239
Classification Level Classification E-value
Superfamily vWA-like 4.77e-38
Family Integrin A (or I) domain 0.000000839
Further Details:      
 
Domain Number 3 Region: 625-723
Classification Level Classification E-value
Superfamily Integrin domains 7.85e-21
Family Integrin domains 0.0048
Further Details:      
 
Domain Number 4 Region: 913-1047
Classification Level Classification E-value
Superfamily Integrin domains 0.0000000144
Family Integrin domains 0.015
Further Details:      
 
Weak hits

Sequence:  ENSPVAP00000000407
Domain Number - Region: 3-78
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 0.00262
Family Integrin alpha N-terminal domain 0.015
Further Details:      
 
Domain Number - Region: 827-871
Classification Level Classification E-value
Superfamily Integrin domains 0.0167
Family Integrin domains 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000000407   Gene: ENSPVAG00000000435   Transcript: ENSPVAT00000000437
Sequence length 1106
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_2966:12463:47668:1 gene:ENSPVAG00000000435 transcript:ENSPVAT00000000437 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VVVGAPQEIKAPNQTGGLYQCDYSMATCEPIHLQVPPEAVNMSLGLSLAFATNPFRLLAC
GPTLHQICKENTYVNGFCLFGLLQQPQLPKTLXXCPQQDSDIAFLIDGSGSIISSDFQRM
KEFVSTMMDQFTKSKTLFSLMQYSEDFQIHFTFKDFKDKPNPRLLVRPIKQLYGETHTAT
GILKVIREVFNSRNGARENARKILVVITDGVKYGDPLEYKDVIPEADREGVIRYVIGXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTQIGSTSSFEYE
MSQEGFSASITSXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIGSYFGASLCSVDVNRD
GSSDLVLIGAPHYYELTRGGQVSVCPLPRGRSRWQCNAVLRGEQGHPWSRFGAALTVLGD
VNGDKLMDVAIGAPGEQENRGAVYLFHGTSELGISLSHSQRIAGSQLSSRLQYFGQSLSG
GQDLTMDGLVDLAVGAQGHVLLLRSQPVLKVXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXDIQSIVTYDLALDPSHQLSRAIFDETKNNTYRQTQSLGLNR
KCETLKLQLPDCVKNSVTPIVLRLNFSLVGQPLSSFGNLRPVLAVDAQRLFTALFPFEKN
CGNDSICQDDLSIAFSFMXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVTFNITLDVESNA
SLGNRVLLKASVTSDNNMPRTNKTEFQLELPVKYTVYMGGSXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXFNNLGQRSLPISVVFWIPIQLNKVAVWEQPQVTFSQNLSSTCHTEERVPP
HSDFLAMLKMTSVLNCSIAVCQRVQCDILSFGSQEEFNVTLKGNLSFDWYIKTSHNYLQV
LSTAEILFDDLMFALLPGQGAFVRAQTETKVEPYEVHDPVPLIVGSSVGGLVLLALITMG
LYKLGFFKRQYKDMMSEAGPETAPPQ
Download sequence
Identical sequences ENSPVAP00000000407 ENSPVAP00000000407

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]