SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000000662 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000000662
Domain Number 1 Region: 108-336
Classification Level Classification E-value
Superfamily vWA-like 6.23e-51
Family Integrin A (or I) domain 0.000000195
Further Details:      
 
Domain Number 2 Region: 20-126,314-565
Classification Level Classification E-value
Superfamily Integrin alpha N-terminal domain 9.42e-50
Family Integrin alpha N-terminal domain 0.00031
Further Details:      
 
Domain Number 3 Region: 788-917
Classification Level Classification E-value
Superfamily Integrin domains 7.32e-26
Family Integrin domains 0.0095
Further Details:      
 
Domain Number 4 Region: 935-1087
Classification Level Classification E-value
Superfamily Integrin domains 0.00000000000889
Family Integrin domains 0.0094
Further Details:      
 
Domain Number 5 Region: 618-718
Classification Level Classification E-value
Superfamily Integrin domains 0.0000000000889
Family Integrin domains 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000000662   Gene: ENSPVAG00000000697   Transcript: ENSPVAT00000000699
Sequence length 1154
Comment pep:known_by_projection genescaffold:pteVam1:GeneScaffold_1856:8574:27513:1 gene:ENSPVAG00000000697 transcript:ENSPVAT00000000699 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTGTGTSLLLLMTLASSVCFNLDTDKPTTFLMDSAGFGHSVVQYANSWVVVGAPQEIKAA
NQTGGLYQCDYSTATCEPIRLQVPPEAVNMSLGLSLTASTNPSQLLACGPTVHHACRENM
YLTGFCFLLSFPSWQAQRLPSALQECPKQEQDIVFLIDGSGSISSNDFAKMLNFVKAVMS
QFQRPNTQFSLMQFSNQFRVHFTFKDFTYNSDPLGLLDSVYQLRGATHTATAIRKVIKQL
FSAPSGARNDASKILIVITDGNKQGDYLDYKDVIPMAEAAGIIRYAVGVGSAFRETNSWK
ELNDIASSPSHEYIFKVENFDALRDIQNQLKEKIFAIEGTQTISSSSFELEMSQEGFSAV
FAPDGPVLEAVGSFSWSGGAFLYPPNISPIFINMSQEHVDMRDSYLGYSTELALWKGVQI
LVLGAPRHQHTGKVVLFAQVSRQWRPKAEVTGTQIGSYFGASLCSVDVDRDGSSDLVLIG
APHYHEPTRGGQVSVCPFPRGRARWQCEFILCGEQGHPWGRFGAALTVLGDVNGDKLMDV
AIGAPGEQENQGAVYLFHGTLGLGISLIHSQXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXXXXALLLRTRPVLRVWVSIRITPAEITRSVFECQEQMPFVQPLVNANVCLHVY
KSSKDRLDLQSSVTFDLTLDPGRLSPRAIFEETKTWNLTRVRVLGLRQHCEDVRFLLLXX
XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
XXXXXXXLKTLVVGSNLELNMEVRVWNDGEDSYGTTVTFFYPPGLSYRRVAGSQSQLQSQ
SLRLTCDSAPAESQGIQSTHCSIKHLIFREGAQITFTATFDVSPKAMLGDRLLLMGNVSS
ENNTPRTSKTTFQLELPVKYAVYTHEGSTKYLNFSTSEEEESSMVQHRYQVNNLGQRGLS
ISVNFLVPVELNQVTVWKEIEVFSPQNPSIQCSSERIVPTESSFMTHIQKNPVLDCSIAD
CLRFRCDIPSFGIQEELDFILKGNLSFGWISQTLQKNVFIVSVAEITFNRSVYSQLPGQE
VFLRAQIEMVEKYEVHNPXXXXXXXXXXXXXXXXXXXXXXXXVGFFKRQYKEMMEKANGG
TAPENGTQTPNKKL
Download sequence
Identical sequences ENSPVAP00000000662 ENSPVAP00000000662

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]