SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSPVAP00000000694 from Pteropus vampyrus 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSPVAP00000000694
Domain Number 1 Region: 2-177
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.71e-68
Family Eukaryotic proteases 0.00000268
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSPVAP00000000694   Gene: ENSPVAG00000000734   Transcript: ENSPVAT00000000733
Sequence length 179
Comment pep:novel scaffold:pteVam1:scaffold_37412:720:1898:-1 gene:ENSPVAG00000000734 transcript:ENSPVAT00000000733 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RIQVRLGEYNIEEEEGTEQFINSAKVIRHPSYSSQTLDNDIMLIKLSSTAALNSRVSTVS
LPSSCASTGTQCLVSGWGNTLSSGTNYPDLLQCLNVPVLSQAKCEAAYPGQITSNMFCAG
YLEGGKDSCQGDSGGPVVCNNKLQGIVSWGYGCAQKNKPGVYTKVCKFLDWIKKTVASN
Download sequence
Identical sequences ENSPVAP00000000694 ENSPVAP00000000694

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]